Using

[Fabricio B. Teixeira]

Hi,

I�ve developed a web service and I am trying to call it, but the following
error is raised: java.io.IOException: No serializer found for class
QuerySequence in registry [EMAIL PROTECTED]
Looking at the web I found out that the WSDD file should have a
<beanMapping> tag. Is It rigth? What shoud I do?

********My java class which is my web service is**********

public class RestoreQuerySequence {

  public QuerySequence Restore(String FastaFile) {

    String line, query_def = null; 
    String query_seq = null;
    String str = ">gi|13431740|sp|P57794|NIFS_ACEDI Cysteine desulfurase
(Nitrogenase metalloclusters                    biosynthesis protein
nifS)\n" +
 
"MNAVYLDNNATTRVDPAAVSAMLPFFTEQFGNASSMHAFGAEVGGALHTARRQLQALLGAEFDHEIVYTA\n" +
 
"GGTESDNTAILSALETQAGRNEIVTSAVEHPAVLALCAWLEKTRGTRVHYIGVDARGRLDIDAYRRALSP\n";
...
    
    while (line != null) {
    ...        
    } //while

    qs.setDefinition(query_def);
    qs.setSequence(query_seq);

    }
    catch (IOException e) {
    System.out.println("Arquivo Fasta n�o encontrado!");           
    }

    return qs;
    }
  
}

*********The QuerySequence class is:**************

public class QuerySequence {
        
  private String fDefinition;
  private String fSequence;
  
  
  public String getDefinition() {
        return fDefinition;
  }

  public String getSequence() {
        return fSequence;
  }

  public void setDefinition(String string) {
        fDefinition = string;
  }

  public void setSequence(String string) {
        fSequence = string;
  }

}

*********And the WSDD is: **************

<deployment xmlns="http://xml.apache.org/axis/wsdd/";  
            xmlns:java="http://xml.apache.org/axis/wsdd/providers/java";>

  <service name="RestoreQuerySequence" provider="java:RPC">
   
    <requestFlow>
      <handler type="soapmonitor"/>
    </requestFlow>  

    <responseFlow>
      <handler type="soapmonitor"/>
    </responseFlow>

    <parameter name="className" value="RestoreQuerySequence"/>
    <parameter name="allowedMethods" value="*"/>

  </service>

</deployment>


Thanks for everything,

Fabricio B. Teixeira

<<attachment: winmail.dat>>