>> Would you please explain how the input of this method will be >> given?
Just assume that this would be a String for now. For example "MFVAWLMLADAELGMGDTTAGEMAVQRGLALHPGHPEAVARLGR".
Hope that helps. Regards, Peter On 07/04/2011 12:26, effat farhana wrote:
Hi, I'm a student of Computer Science and Engineering background. I heard about GSoC a few days earlier and very much eager to participate in it. I'm quite familiar with C++, Java multithreading. The idea of this project proposal seems quite interesting to me. One of the methods to be implemented is to calculate the numbers of different amino acids in protein. Would you please explain how the input of this method will be given? Will the protein sequence be represented by String as sequence of amino acids and I've just count the different types of amino acid? Looking forward for your quick reply Thanks in advance farhana _______________________________________________ Biojava-l mailing list - [email protected] http://lists.open-bio.org/mailman/listinfo/biojava-l
_______________________________________________ Biojava-l mailing list - [email protected] http://lists.open-bio.org/mailman/listinfo/biojava-l
