Hi!I've just written a new validation program which validates the sequence of a coordinate model to detect register errors caused by extra or missing residues in the chain trace.
This was inspired by a recent message from the Richardsons, about something similar in molprobity (I think, I can't find it any more). I realised I already had all the code to do this in buccaneer. However, the approach to sequencing implemented in buccaneer is sufficiently different to anything used elsewhere that it should provide an independent check.
It may be run with phases from experimental phasing, or it can calculate its own phases using a side-chain-omit process. In this case it can be used after molecular replacement, or to validate structures in the PDB.
The software includes a GUI and auto-installer script, and is available for Linux/x86, Mac/x86 and Mac/ppc. You can download it from here:
http://www.ysbl.york.ac.uk/~cowtan/sequins/sequins.htmlThe installer will create a new task in the 'Validation and Depostition' menu, labelled 'Sequence validation'.
I've attached a screenshot of the GUI. Below is sample output, showing a case in which there is a 30 residue register shift in the model. Note the '+' and '-' in the modified sequence, and the warning message below.
############################################################### ############################################################### ############################################################### ### CCP4 6.0: csequins version 0.0.1 : 29/08/07## ############################################################### User: cowtan Run date: 3/ 9/2007 Run time: 11:44:05 Please reference: Collaborative Computational Project, Number 4. 1994."The CCP4 Suite: Programs for Protein Crystallography". Acta Cryst. D50, 760-763.
as well as any specific reference in the program write-up. Copyright 2007 Kevin Cowtan and University of York. All rights reserved. Please reference: Cowtan K. (2006) Acta Cryst. D62, 1002-1011. pdbin-ref /home/cowtan/test/reference-1tqw.pdb mtzin-ref /home/cowtan/test/reference-1tqw.mtz colin-ref-fo /*/*/[FP.F_sigF.F,FP.F_sigF.sigF] colin-ref-hl /*/*/[FC.ABCD.A,FC.ABCD.B,FC.ABCD.C,FC.ABCD.D] mtzin-wrk modified.mtz colin-wrk-fo /*/*/[FP,SIGFP] pdbin-wrk modified.pdb correlation-mode ------------------------------------------------------------------------ CHAIN: AOriginal: MKTRADLFAFFDAHGVDHKTLDHPPVFRVEEGLEIKAAMPGGHTKNLFLKAKGQLWLISALGETTIDLKKLHHVIGSGRLASFGPQEMMLETLGVTPGSVTAFGLINDTEKRVRFVLDKALADSDPVNFHPLKNDATTAVSQAGLRRFLAALGVEPMIVDFAAMEVVG Modified: ??TRADLFAFFDAHGVDHKTLDHPPVFRVEEGLEIKAAMPGGHTKNLFLK+AKGQLWLISALGETTIDLKKLHHVIGSGRLASFGP-MMLETLGVTPGSVTAFGLINDTEKRVRFVLDKALADSDPVNFHPLKNDATTAVSQAGLRRFLAALGVEPMIVDFAAMEVV?
Confidence: 0.999992 WARNING: The supplied data suggests a partial sequence register error. ------------------------------------------------------------------------ Times: User: 36.9s System: 0.1s Elapsed: 0:38
<<inline: sequins-gui.png>>
