On 02/10/2012 07:35 AM, intekhab alam wrote:
Hi all
I have a 3A dataset for a protein-protein complex. I have successfully
build the first protein and refined it to R/Rfree 24/28. I can see some
density for my second protein but the density is a bit noisy. I have
attached the coot image of the density. I want to model the aminoacid
having sequence as given
peptide:
MGKKGKNKKGRGRPGVFRTRGLTDEEYDEFKKRRESRGGKYSIDDYLADREREEELLERDEEEAIFGDGFGLE
1.Based on map features which segemnt should i start with.
2. Is there anyway that i can build the best fit segment of my second
protein.
I tried autobuild but it failed to build any peptide for my second protein.
Your help is highly appreciated.
regards
Try buccaneer - it should work very easily with that density..
Eleanor
