Hi everyone,

I have run the ample for a 377 amino acids protein and generated 500
models. But I did not get any  ensemble model and got error message that
could not load any ensembles after running create_ensembles. I am here
attaching the ample.log and debug.log file.
Any one suggest me why this happened?

Thanks and regards
#########################################################################
#########################################################################
#########################################################################
# CCP4: AMPLE - Ab Initio Modelling Molecular Replacement               #
#########################################################################

The authors of specific programs should be referenced where applicable:

AMPLE: J. Bibby, R. M. Keegan, O. Mayans, M. D. Winn and D. J. Rigden.
AMPLE: a cluster-and-truncate approach to solve the crystal structures of small proteins using
rapidly computed ab initio models. (2012). Acta Cryst. D68, 1622-1631 [ doi:10.1107/S0907444912039194 ]

CCP4: Collaborative Computational Project, Number 4. (1994), The CCP4 Suite: Programs
for Protein Crystallography. Acta Cryst. D50, 760-763

SHELX: "A short history of SHELX". Sheldrick, G.M. (2008). Acta Cryst. A64, 112-122

SCWRL: G. G. Krivov, M. V. Shapovalov, and R. L. Dunbrack, Jr. Improved prediction of protein
side-chain conformations with SCWRL4. Proteins (2009).

MaxCluster: http://www.sbg.bio.ic.ac.uk/maxcluster/

MOLREP: A.A.Vagin & A.Teplyakov (1997) J. Appl. Cryst. 30, 1022-1025

MrBUMP: R.M.Keegan and M.D.Winn (2007) Acta Cryst. D63, 447-457

PHASER: McCoy, A.J., Grosse-Kunstleve, R.W., Adams, P.D., Winn, M.D.,
Storoni, L.C. & Read, R.J. (2007)
Phaser crystallographic software J. Appl. Cryst. 40, 658-674

REFMAC: G.N. Murshudov, A.A.Vagin and E.J.Dodson, (1997) Refinement of Macromolecular
Structures by the Maximum-Likelihood Method. Acta Cryst. D53, 240-255

SPICKER: Y. Zhang, J. Skolnick, SPICKER: Approach to clustering protein structures for
near-native model selection, Journal of Computational Chemistry, 2004 25: 865-871

Theseus: THESEUS: Maximum likelihood superpositioning and analysis of macromolecular structures.
Theobald, Douglas L. & Wuttke, Deborah S. (2006b) Bioinformatics 22(17):2171-2172 [Open Access]
Supplementary Materials for Theobald and Wuttke 2006b.



AMPLE version: 1.0.0


Invoked with command-line:
/home/user1/Documents/destination/ccp4-6.5/bin/ample.py -mtz /home/user1/Documents/projects/FmtA/Fmt_vik/ccp4i/fmt-c2221-vikram.mtz -fasta /home/user1/Documents/projects/FmtA/Fmt_vik/ccp4i/ample_21_oct_2016/fmtA.fasta -mr_sequence /home/user1/Documents/projects/FmtA/Fmt_vik/ccp4i/ample_21_oct_2016/fmtA.fasta -nmodels 500 -name MVD0 -run_dir /home/user1/Documents/projects/FmtA/Fmt_vik/ccp4i -nproc 1 -make_models True -rosetta_dir /home/user1/Downloads/rosetta_bin_linux_2016.32.58837_bundle -frags_3mers /home/user1/Documents/projects/FmtA/Fmt_vik/ccp4i/ample_21_oct_2016/aat000_03_05.200_v1_3 -frags_9mers /home/user1/Documents/projects/FmtA/Fmt_vik/ccp4i/ample_21_oct_2016/aat000_09_05.200_v1_3 -make_frags False -F F -SIGF SIGF -FREE FreeR_flag -early_terminate True -use_arpwarp False


Running in directory: /home/user1/Documents/projects/FmtA/Fmt_vik/ccp4i/AMPLE_9


Fasta is 377 amino acids long

Using MTZ file: /home/user1/Documents/projects/FmtA/Fmt_vik/ccp4i/fmt-c2221-vikram.mtz

Cannot find maxcluster binary in path so attempting to download it directory: /home/user1/.ample

No ample rcdir found so creating in: /home/user1/.ample

Attempting to download maxcluster binary from: http://www.sbg.bio.ic.ac.uk/~maxcluster/maxcluster64bit

*** Cannot find shelxe executable in PATH - turning off use of SHELXE. ***
    SHELXE is recommended for the best chance of success. We recommend you install shelxe from:
    http://shelx.uni-ac.gwdg.de/SHELX/
    and install it in your PATH so that AMPLE can use it.
    

Using ROSETTA so checking options

Rosetta version is: 3.6

NOT making Fragments


Making Rosetta Models

Rebuilding in Bucaneer

Not rebuilding in ARP/wARP

All needed programs are found, continuing Run

----- making Rosetta models--------

making 500 models...

Checking pdbs in directory: /home/user1/Documents/projects/FmtA/Fmt_vik/ccp4i/AMPLE_9/models

check_pdb_directory - pdb files all seem valid

Ensembling models in directory: /home/user1/Documents/projects/FmtA/Fmt_vik/ccp4i/AMPLE_9/ensemble_workdir

* Running SPICKER to cluster models *

truncating at: 49.699237 in directory /home/user1/Documents/projects/FmtA/Fmt_vik/ccp4i/AMPLE_9/ensemble_workdir/truncate_1/tlevel_100

truncating at: 39.252605 in directory /home/user1/Documents/projects/FmtA/Fmt_vik/ccp4i/AMPLE_9/ensemble_workdir/truncate_1/tlevel_95

truncating at: 31.159337 in directory /home/user1/Documents/projects/FmtA/Fmt_vik/ccp4i/AMPLE_9/ensemble_workdir/truncate_1/tlevel_90

truncating at: 27.050171 in directory /home/user1/Documents/projects/FmtA/Fmt_vik/ccp4i/AMPLE_9/ensemble_workdir/truncate_1/tlevel_85

truncating at: 23.309889 in directory /home/user1/Documents/projects/FmtA/Fmt_vik/ccp4i/AMPLE_9/ensemble_workdir/truncate_1/tlevel_80

truncating at: 20.874194 in directory /home/user1/Documents/projects/FmtA/Fmt_vik/ccp4i/AMPLE_9/ensemble_workdir/truncate_1/tlevel_75

truncating at: 19.027473 in directory /home/user1/Documents/projects/FmtA/Fmt_vik/ccp4i/AMPLE_9/ensemble_workdir/truncate_1/tlevel_70

truncating at: 17.406585 in directory /home/user1/Documents/projects/FmtA/Fmt_vik/ccp4i/AMPLE_9/ensemble_workdir/truncate_1/tlevel_65

truncating at: 15.809747 in directory /home/user1/Documents/projects/FmtA/Fmt_vik/ccp4i/AMPLE_9/ensemble_workdir/truncate_1/tlevel_60

truncating at: 14.641427 in directory /home/user1/Documents/projects/FmtA/Fmt_vik/ccp4i/AMPLE_9/ensemble_workdir/truncate_1/tlevel_55

truncating at: 13.268672 in directory /home/user1/Documents/projects/FmtA/Fmt_vik/ccp4i/AMPLE_9/ensemble_workdir/truncate_1/tlevel_50

truncating at: 12.065652 in directory /home/user1/Documents/projects/FmtA/Fmt_vik/ccp4i/AMPLE_9/ensemble_workdir/truncate_1/tlevel_45

truncating at: 9.915939 in directory /home/user1/Documents/projects/FmtA/Fmt_vik/ccp4i/AMPLE_9/ensemble_workdir/truncate_1/tlevel_40

truncating at: 9.056308 in directory /home/user1/Documents/projects/FmtA/Fmt_vik/ccp4i/AMPLE_9/ensemble_workdir/truncate_1/tlevel_34

truncating at: 8.068462 in directory /home/user1/Documents/projects/FmtA/Fmt_vik/ccp4i/AMPLE_9/ensemble_workdir/truncate_1/tlevel_29

truncating at: 7.189155 in directory /home/user1/Documents/projects/FmtA/Fmt_vik/ccp4i/AMPLE_9/ensemble_workdir/truncate_1/tlevel_24

truncating at: 6.380863 in directory /home/user1/Documents/projects/FmtA/Fmt_vik/ccp4i/AMPLE_9/ensemble_workdir/truncate_1/tlevel_19

truncating at: 5.512833 in directory /home/user1/Documents/projects/FmtA/Fmt_vik/ccp4i/AMPLE_9/ensemble_workdir/truncate_1/tlevel_14

truncating at: 4.638785 in directory /home/user1/Documents/projects/FmtA/Fmt_vik/ccp4i/AMPLE_9/ensemble_workdir/truncate_1/tlevel_9

truncating at: 3.716708 in directory /home/user1/Documents/projects/FmtA/Fmt_vik/ccp4i/AMPLE_9/ensemble_workdir/truncate_1/tlevel_4

**********************************************************************
********************          AMPLE ERROR          *******************
**********************************************************************

Could not load any ensembles after running create_ensembles!

**********************************************************************

More information may be found in the debug log file: /home/user1/Documents/projects/FmtA/Fmt_vik/ccp4i/AMPLE_9/debug.log

If you believe that this is an error with AMPLE, please email: [email protected]
providing as much information as you can about how you ran the program.

Please include the debug logfile with your email: /home/user1/Documents/projects/FmtA/Fmt_vik/ccp4i/AMPLE_9/debug.log


2016-10-22 00:22:56,702 - root - INFO - #########################################################################
#########################################################################
#########################################################################
# CCP4: AMPLE - Ab Initio Modelling Molecular Replacement               #
#########################################################################

The authors of specific programs should be referenced where applicable:

AMPLE: J. Bibby, R. M. Keegan, O. Mayans, M. D. Winn and D. J. Rigden.
AMPLE: a cluster-and-truncate approach to solve the crystal structures of small proteins using
rapidly computed ab initio models. (2012). Acta Cryst. D68, 1622-1631 [ doi:10.1107/S0907444912039194 ]

CCP4: Collaborative Computational Project, Number 4. (1994), The CCP4 Suite: Programs
for Protein Crystallography. Acta Cryst. D50, 760-763

SHELX: "A short history of SHELX". Sheldrick, G.M. (2008). Acta Cryst. A64, 112-122

SCWRL: G. G. Krivov, M. V. Shapovalov, and R. L. Dunbrack, Jr. Improved prediction of protein
side-chain conformations with SCWRL4. Proteins (2009).

MaxCluster: http://www.sbg.bio.ic.ac.uk/maxcluster/

MOLREP: A.A.Vagin & A.Teplyakov (1997) J. Appl. Cryst. 30, 1022-1025

MrBUMP: R.M.Keegan and M.D.Winn (2007) Acta Cryst. D63, 447-457

PHASER: McCoy, A.J., Grosse-Kunstleve, R.W., Adams, P.D., Winn, M.D.,
Storoni, L.C. & Read, R.J. (2007)
Phaser crystallographic software J. Appl. Cryst. 40, 658-674

REFMAC: G.N. Murshudov, A.A.Vagin and E.J.Dodson, (1997) Refinement of Macromolecular
Structures by the Maximum-Likelihood Method. Acta Cryst. D53, 240-255

SPICKER: Y. Zhang, J. Skolnick, SPICKER: Approach to clustering protein structures for
near-native model selection, Journal of Computational Chemistry, 2004 25: 865-871

Theseus: THESEUS: Maximum likelihood superpositioning and analysis of macromolecular structures.
Theobald, Douglas L. & Wuttke, Deborah S. (2006b) Bioinformatics 22(17):2171-2172 [Open Access]
Supplementary Materials for Theobald and Wuttke 2006b.


2016-10-22 00:22:56,702 - root - INFO - AMPLE version: 1.0.0

2016-10-22 00:22:56,702 - root - INFO - Invoked with command-line:
/home/user1/Documents/destination/ccp4-6.5/bin/ample.py -mtz /home/user1/Documents/projects/FmtA/Fmt_vik/ccp4i/fmt-c2221-vikram.mtz -fasta /home/user1/Documents/projects/FmtA/Fmt_vik/ccp4i/ample_21_oct_2016/fmtA.fasta -mr_sequence /home/user1/Documents/projects/FmtA/Fmt_vik/ccp4i/ample_21_oct_2016/fmtA.fasta -nmodels 500 -name MVD0 -run_dir /home/user1/Documents/projects/FmtA/Fmt_vik/ccp4i -nproc 1 -make_models True -rosetta_dir /home/user1/Downloads/rosetta_bin_linux_2016.32.58837_bundle -frags_3mers /home/user1/Documents/projects/FmtA/Fmt_vik/ccp4i/ample_21_oct_2016/aat000_03_05.200_v1_3 -frags_9mers /home/user1/Documents/projects/FmtA/Fmt_vik/ccp4i/ample_21_oct_2016/aat000_09_05.200_v1_3 -make_frags False -F F -SIGF SIGF -FREE FreeR_flag -early_terminate True -use_arpwarp False

2016-10-22 00:22:56,702 - root - INFO - Running in directory: /home/user1/Documents/projects/FmtA/Fmt_vik/ccp4i/AMPLE_9

2016-10-22 00:22:56,706 - root - DEBUG - Parsing FASTA file
2016-10-22 00:22:56,707 - root - INFO - Fasta is 377 amino acids long
2016-10-22 00:22:56,769 - root - INFO - Using MTZ file: /home/user1/Documents/projects/FmtA/Fmt_vik/ccp4i/fmt-c2221-vikram.mtz
2016-10-22 00:22:56,770 - root - DEBUG - Looking for executable: maxcluster
2016-10-22 00:22:56,770 - root - DEBUG - Checking paths: ['/home/user1/Documents/destination/ccp4-6.5/share/dbccp4i/bin', '/home/user1/Documents/destination/arp_warp_7.5/bin/bin-x86_64-Linux', '/home/user1/Documents/destination/ccp4-6.5/etc', '/home/user1/Documents/destination/ccp4-6.5/bin', '/home/user1/Documents/destination/ccp4-6.5/share/xia2/Applications', '/usr/local/phenix-1.10.1-2155/build/bin', '/usr/lib64/qt-3.3/bin', '/usr/local/bin', '/usr/local/sbin', '/usr/bin', '/usr/sbin', '/bin', '/sbin', '/home/programs/cns_solve_1.3/bin', '/home/user1/.local/bin', '/home/user1/bin', '/home/programs/cns_solve_1.3/bin', '/home/user1/.ample']
2016-10-22 00:22:56,770 - root - INFO - Cannot find maxcluster binary in path so attempting to download it directory: /home/user1/.ample
2016-10-22 00:22:56,770 - root - INFO - No ample rcdir found so creating in: /home/user1/.ample
2016-10-22 00:22:56,817 - root - INFO - Attempting to download maxcluster binary from: http://www.sbg.bio.ic.ac.uk/~maxcluster/maxcluster64bit
2016-10-22 00:23:05,701 - root - DEBUG - Looking for executable: spicker
2016-10-22 00:23:05,701 - root - DEBUG - Checking paths: ['/home/user1/Documents/destination/ccp4-6.5/share/dbccp4i/bin', '/home/user1/Documents/destination/arp_warp_7.5/bin/bin-x86_64-Linux', '/home/user1/Documents/destination/ccp4-6.5/etc', '/home/user1/Documents/destination/ccp4-6.5/bin', '/home/user1/Documents/destination/ccp4-6.5/share/xia2/Applications', '/usr/local/phenix-1.10.1-2155/build/bin', '/usr/lib64/qt-3.3/bin', '/usr/local/bin', '/usr/local/sbin', '/usr/bin', '/usr/sbin', '/bin', '/sbin', '/home/programs/cns_solve_1.3/bin', '/home/user1/.local/bin', '/home/user1/bin', '/home/programs/cns_solve_1.3/bin']
2016-10-22 00:23:05,701 - root - DEBUG - Found executable spicker in directory /home/user1/Documents/destination/ccp4-6.5/bin
2016-10-22 00:23:05,701 - root - DEBUG - find_exe found executable: /home/user1/Documents/destination/ccp4-6.5/bin/spicker
2016-10-22 00:23:05,701 - root - DEBUG - Looking for executable: theseus
2016-10-22 00:23:05,701 - root - DEBUG - Checking paths: ['/home/user1/Documents/destination/ccp4-6.5/share/dbccp4i/bin', '/home/user1/Documents/destination/arp_warp_7.5/bin/bin-x86_64-Linux', '/home/user1/Documents/destination/ccp4-6.5/etc', '/home/user1/Documents/destination/ccp4-6.5/bin', '/home/user1/Documents/destination/ccp4-6.5/share/xia2/Applications', '/usr/local/phenix-1.10.1-2155/build/bin', '/usr/lib64/qt-3.3/bin', '/usr/local/bin', '/usr/local/sbin', '/usr/bin', '/usr/sbin', '/bin', '/sbin', '/home/programs/cns_solve_1.3/bin', '/home/user1/.local/bin', '/home/user1/bin', '/home/programs/cns_solve_1.3/bin']
2016-10-22 00:23:05,702 - root - DEBUG - Found executable theseus in directory /home/user1/Documents/destination/ccp4-6.5/bin
2016-10-22 00:23:05,702 - root - DEBUG - find_exe found executable: /home/user1/Documents/destination/ccp4-6.5/bin/theseus
2016-10-22 00:23:05,702 - root - DEBUG - Looking for executable: shelxe
2016-10-22 00:23:05,702 - root - DEBUG - Checking paths: ['/home/user1/Documents/destination/ccp4-6.5/share/dbccp4i/bin', '/home/user1/Documents/destination/arp_warp_7.5/bin/bin-x86_64-Linux', '/home/user1/Documents/destination/ccp4-6.5/etc', '/home/user1/Documents/destination/ccp4-6.5/bin', '/home/user1/Documents/destination/ccp4-6.5/share/xia2/Applications', '/usr/local/phenix-1.10.1-2155/build/bin', '/usr/lib64/qt-3.3/bin', '/usr/local/bin', '/usr/local/sbin', '/usr/bin', '/usr/sbin', '/bin', '/sbin', '/home/programs/cns_solve_1.3/bin', '/home/user1/.local/bin', '/home/user1/bin', '/home/programs/cns_solve_1.3/bin']
2016-10-22 00:23:05,702 - root - WARNING - *** Cannot find shelxe executable in PATH - turning off use of SHELXE. ***
    SHELXE is recommended for the best chance of success. We recommend you install shelxe from:
    http://shelx.uni-ac.gwdg.de/SHELX/
    and install it in your PATH so that AMPLE can use it.
    
2016-10-22 00:23:05,702 - root - INFO - Using ROSETTA so checking options
2016-10-22 00:23:05,702 - root - DEBUG - Version file for Rosetta not found - checking to see if its 3.5 or 3.6
2016-10-22 00:23:05,702 - root - INFO - Rosetta version is: 3.6
2016-10-22 00:23:05,704 - root - INFO - NOT making Fragments
2016-10-22 00:23:05,704 - root - INFO - 
Making Rosetta Models
2016-10-22 00:23:05,704 - root - INFO - Rebuilding in Bucaneer
2016-10-22 00:23:05,704 - root - INFO - Not rebuilding in ARP/wARP
2016-10-22 00:23:05,705 - root - INFO - All needed programs are found, continuing Run
2016-10-22 00:23:05,705 - root - DEBUG - Parameters Used in this Run

F : F
FREE : FreeR_flag
LGA : None
ROSETTA_cluster : None
SIGF : SIGF
alignment_file : None
all_atom : True
ample_log : /home/user1/Documents/projects/FmtA/Fmt_vik/ccp4i/AMPLE_9/AMPLE.log
ample_version : 1.0.0
arpwarp_cycles : 10
benchmark_mode : False
blast_dir : None
buccaneer_cycles : 5
ccp4_jobid : None
cluster_method : spicker
constraints_file : None
debug : False
devel_mode : None
domain_all_chains_pdb : None
domain_termini_distance : 0
dry_run : False
early_terminate : True
ensembles_dir : None
fast_protein_cluster_exe : None
fasta : /home/user1/Documents/projects/FmtA/Fmt_vik/ccp4i/AMPLE_9/MVD0_.fasta
fasta_length : 377
frags_3mers : /home/user1/Documents/projects/FmtA/Fmt_vik/ccp4i/ample_21_oct_2016/aat000_03_05.200_v1_3
frags_9mers : /home/user1/Documents/projects/FmtA/Fmt_vik/ccp4i/ample_21_oct_2016/aat000_09_05.200_v1_3
homologs : False
ideal_helices : False
import_ensembles : False
import_models : False
improve_template : None
make_frags : False
make_models : True
max_array_jobs : None
max_ensemble_models : 30
maxcluster_exe : /home/user1/.ample/maxcluster
missing_domain : False
models : None
models_dir : /home/user1/Documents/projects/FmtA/Fmt_vik/ccp4i/AMPLE_9/models
molrep_only : False
mr_keys : []
mr_sequence : /home/user1/Documents/projects/FmtA/Fmt_vik/ccp4i/ample_21_oct_2016/fmtA.fasta
mrbump_programs : ['phaser']
mtz : /home/user1/Documents/projects/FmtA/Fmt_vik/ccp4i/fmt-c2221-vikram.mtz
name : MVD0_
native_pdb : None
nmasu : 0
nmodels : 500
nmr_model_in : None
nmr_process : None
nmr_remodel : False
nmr_remodel_fasta : None
nproc : 1
nr : None
num_clusters : 1
output_pdb : ample_output.pdb
percent : 5
phaser_kill : 360
phaser_only : True
phenix_exe : None
psipred_ss2 : None
purge : False
quick_mode : None
rcdir : /home/user1/.ample
results_path : /home/user1/Documents/projects/FmtA/Fmt_vik/ccp4i/AMPLE_9/resultsd.pkl
rg_reweight : None
rosetta_AbinitioRelax : None
rosetta_db : None
rosetta_dir : /home/user1/Downloads/rosetta_bin_linux_2016.32.58837_bundle
rosetta_fragments_exe : None
rosetta_version : None
run_dir : /home/user1/Documents/projects/FmtA/Fmt_vik/ccp4i
scwrl_exe : None
sequence : SIALIFHRLQTKTHSIDPIHKETKLSDNEKYLVDRNKEKVAPSKLKEVYNSKDPKYKKIDKYLQSSLFNGSVAIYENGKLKMSKGYGYQDFEKGIKNTPNTMFLIGSAQKFSTGLLLKQLEEEHKININDPVSKYLPWFKTSKPIPLKDLMLHQSGLYKYKSSKDYKNLDQAVKAIQKRGIDPKKYKKHMYNDGNYLVLAKVIEEVTGKSYAENYYTKIGDPLKLQHTAFYDEQPFKKYLAKGYAYNSTGLSFLRPNILDQYYGAGNLYMTPTDMGKLITQIQQYKLFSPKITNPLLHEFGTKKYPDEYRYGFYAKPTLNRLNGGFFGQVFTVYYNDKYVVVLALNVKGNNEVRIKHIYNDILKQNKPYNTKGVIVQ
sf_cif : None
shelx_cycles : 15
shelxe_exe : shelxe
shelxe_rebuild : False
shelxe_rebuild_arpwarp : False
shelxe_rebuild_buccaneer : False
spicker_exe : /home/user1/Documents/destination/ccp4-6.5/bin/spicker
split_mr : False
submit_array : True
submit_cluster : False
submit_max_array : None
submit_qtype : None
submit_queue : None
theseus_exe : /home/user1/Documents/destination/ccp4-6.5/bin/theseus
top_model_only : False
transmembrane : False
transmembrane_lipofile : None
transmembrane_octopusfile : None
transmembrane_spanfile : None
truncation_method : percent
truncation_pruning : none
use_arpwarp : False
use_buccaneer : True
use_homs : True
use_scwrl : False
use_shelxe : False
webserver_uri : None
work_dir : /home/user1/Documents/projects/FmtA/Fmt_vik/ccp4i/AMPLE_9

2016-10-22 00:23:05,705 - root - INFO - ----- making Rosetta models--------
2016-10-22 00:23:05,705 - root - INFO - making 500 models...
2016-10-22 00:23:05,705 - root - DEBUG - In directory /home/user1/Documents/projects/FmtA/Fmt_vik/ccp4i/AMPLE_9/modelling
Running command: /home/user1/Documents/projects/FmtA/Fmt_vik/ccp4i/AMPLE_9/modelling/job_0/model_0.sh
2016-10-22 00:23:05,706 - root - DEBUG - Logfile is: model_0.log
2016-10-29 18:25:21,676 - root - INFO - Checking pdbs in directory: /home/user1/Documents/projects/FmtA/Fmt_vik/ccp4i/AMPLE_9/models
2016-10-29 18:25:31,296 - root - INFO - check_pdb_directory - pdb files all seem valid
2016-10-29 18:25:31,301 - root - INFO - Ensembling models in directory: /home/user1/Documents/projects/FmtA/Fmt_vik/ccp4i/AMPLE_9/ensemble_workdir
2016-10-29 18:25:31,301 - root - INFO - * Running SPICKER to cluster models *
2016-10-29 18:25:31,301 - root - DEBUG - Running spicker in directory: /home/user1/Documents/projects/FmtA/Fmt_vik/ccp4i/AMPLE_9/ensemble_workdir/spicker
2016-10-29 18:26:02,003 - root - DEBUG - In directory /home/user1/Documents/projects/FmtA/Fmt_vik/ccp4i/AMPLE_9/ensemble_workdir/spicker
Running command: /home/user1/Documents/destination/ccp4-6.5/bin/spicker
2016-10-29 18:26:02,004 - root - DEBUG - Logfile is: spicker.log
2016-10-29 18:26:03,773 - root - DEBUG - Processing spicker output file: /home/user1/Documents/projects/FmtA/Fmt_vik/ccp4i/AMPLE_9/ensemble_workdir/spicker/str.txt
2016-10-29 18:26:03,774 - root - DEBUG - ---- Spicker Results ----

Cluster: 1
* number of models: 2
* files are listed in file: /home/user1/Documents/projects/FmtA/Fmt_vik/ccp4i/AMPLE_9/ensemble_workdir/spicker/spicker_cluster_1.list
* centroid model is: /home/user1/Documents/projects/FmtA/Fmt_vik/ccp4i/AMPLE_9/models/model_176.pdb

Cluster: 2
* number of models: 2

Cluster: 3
* number of models: 1

Cluster: 4
* number of models: 1

Cluster: 5
* number of models: 1

Cluster: 6
* number of models: 1

Cluster: 7
* number of models: 1

Cluster: 8
* number of models: 1

Cluster: 9
* number of models: 1

Cluster: 10
* number of models: 1


2016-10-29 18:26:03,775 - root - DEBUG - In directory /home/user1/Documents/projects/FmtA/Fmt_vik/ccp4i/AMPLE_9/ensemble_workdir/truncate_1
Running command: /home/user1/Documents/destination/ccp4-6.5/bin/theseus -a0 -r theseus ../../models/model_176.pdb ../../models/model_350.pdb
2016-10-29 18:26:03,775 - root - DEBUG - Logfile is: /home/user1/Documents/projects/FmtA/Fmt_vik/ccp4i/AMPLE_9/ensemble_workdir/truncate_1/theseus.log
2016-10-29 18:26:03,899 - root - INFO - truncating at: 49.699237 in directory /home/user1/Documents/projects/FmtA/Fmt_vik/ccp4i/AMPLE_9/ensemble_workdir/truncate_1/tlevel_100
2016-10-29 18:26:03,961 - root - INFO - truncating at: 39.252605 in directory /home/user1/Documents/projects/FmtA/Fmt_vik/ccp4i/AMPLE_9/ensemble_workdir/truncate_1/tlevel_95
2016-10-29 18:26:04,021 - root - INFO - truncating at: 31.159337 in directory /home/user1/Documents/projects/FmtA/Fmt_vik/ccp4i/AMPLE_9/ensemble_workdir/truncate_1/tlevel_90
2016-10-29 18:26:04,081 - root - INFO - truncating at: 27.050171 in directory /home/user1/Documents/projects/FmtA/Fmt_vik/ccp4i/AMPLE_9/ensemble_workdir/truncate_1/tlevel_85
2016-10-29 18:26:04,143 - root - INFO - truncating at: 23.309889 in directory /home/user1/Documents/projects/FmtA/Fmt_vik/ccp4i/AMPLE_9/ensemble_workdir/truncate_1/tlevel_80
2016-10-29 18:26:04,204 - root - INFO - truncating at: 20.874194 in directory /home/user1/Documents/projects/FmtA/Fmt_vik/ccp4i/AMPLE_9/ensemble_workdir/truncate_1/tlevel_75
2016-10-29 18:26:04,264 - root - INFO - truncating at: 19.027473 in directory /home/user1/Documents/projects/FmtA/Fmt_vik/ccp4i/AMPLE_9/ensemble_workdir/truncate_1/tlevel_70
2016-10-29 18:26:04,323 - root - INFO - truncating at: 17.406585 in directory /home/user1/Documents/projects/FmtA/Fmt_vik/ccp4i/AMPLE_9/ensemble_workdir/truncate_1/tlevel_65
2016-10-29 18:26:04,380 - root - INFO - truncating at: 15.809747 in directory /home/user1/Documents/projects/FmtA/Fmt_vik/ccp4i/AMPLE_9/ensemble_workdir/truncate_1/tlevel_60
2016-10-29 18:26:04,436 - root - INFO - truncating at: 14.641427 in directory /home/user1/Documents/projects/FmtA/Fmt_vik/ccp4i/AMPLE_9/ensemble_workdir/truncate_1/tlevel_55
2016-10-29 18:26:04,491 - root - INFO - truncating at: 13.268672 in directory /home/user1/Documents/projects/FmtA/Fmt_vik/ccp4i/AMPLE_9/ensemble_workdir/truncate_1/tlevel_50
2016-10-29 18:26:04,545 - root - INFO - truncating at: 12.065652 in directory /home/user1/Documents/projects/FmtA/Fmt_vik/ccp4i/AMPLE_9/ensemble_workdir/truncate_1/tlevel_45
2016-10-29 18:26:04,598 - root - INFO - truncating at: 9.915939 in directory /home/user1/Documents/projects/FmtA/Fmt_vik/ccp4i/AMPLE_9/ensemble_workdir/truncate_1/tlevel_40
2016-10-29 18:26:04,649 - root - INFO - truncating at: 9.056308 in directory /home/user1/Documents/projects/FmtA/Fmt_vik/ccp4i/AMPLE_9/ensemble_workdir/truncate_1/tlevel_34
2016-10-29 18:26:04,699 - root - INFO - truncating at: 8.068462 in directory /home/user1/Documents/projects/FmtA/Fmt_vik/ccp4i/AMPLE_9/ensemble_workdir/truncate_1/tlevel_29
2016-10-29 18:26:04,748 - root - INFO - truncating at: 7.189155 in directory /home/user1/Documents/projects/FmtA/Fmt_vik/ccp4i/AMPLE_9/ensemble_workdir/truncate_1/tlevel_24
2016-10-29 18:26:04,796 - root - INFO - truncating at: 6.380863 in directory /home/user1/Documents/projects/FmtA/Fmt_vik/ccp4i/AMPLE_9/ensemble_workdir/truncate_1/tlevel_19
2016-10-29 18:26:04,843 - root - INFO - truncating at: 5.512833 in directory /home/user1/Documents/projects/FmtA/Fmt_vik/ccp4i/AMPLE_9/ensemble_workdir/truncate_1/tlevel_14
2016-10-29 18:26:04,888 - root - INFO - truncating at: 4.638785 in directory /home/user1/Documents/projects/FmtA/Fmt_vik/ccp4i/AMPLE_9/ensemble_workdir/truncate_1/tlevel_9
2016-10-29 18:26:04,931 - root - INFO - truncating at: 3.716708 in directory /home/user1/Documents/projects/FmtA/Fmt_vik/ccp4i/AMPLE_9/ensemble_workdir/truncate_1/tlevel_4
2016-10-29 18:26:04,972 - root - DEBUG - In directory /home/user1/Documents/projects/FmtA/Fmt_vik/ccp4i/AMPLE_9/ensemble_workdir/truncate_1
Running command: /home/user1/.ample/maxcluster -l /home/user1/Documents/projects/FmtA/Fmt_vik/ccp4i/AMPLE_9/ensemble_workdir/truncate_1/files.list -L 4 -rmsd -d 1000 -bb -C0
2016-10-29 18:26:04,972 - root - DEBUG - Logfile is: /home/user1/Documents/projects/FmtA/Fmt_vik/ccp4i/AMPLE_9/ensemble_workdir/truncate_1/maxcluster.log
2016-10-29 18:26:05,052 - root - DEBUG - subclustering files under radius: 1
2016-10-29 18:26:05,052 - root - DEBUG - Clustered 1 files
2016-10-29 18:26:05,052 - root - DEBUG - Clustered fewer than 2 files using radius 1 -  in truncation dir /home/user1/Documents/projects/FmtA/Fmt_vik/ccp4i/AMPLE_9/ensemble_workdir/truncate_1/tlevel_100 SKIPPING
2016-10-29 18:26:05,052 - root - DEBUG - subclustering files under radius: 2
2016-10-29 18:26:05,053 - root - DEBUG - Clustered 1 files
2016-10-29 18:26:05,053 - root - DEBUG - Clustered fewer than 2 files using radius 2 -  in truncation dir /home/user1/Documents/projects/FmtA/Fmt_vik/ccp4i/AMPLE_9/ensemble_workdir/truncate_1/tlevel_100 SKIPPING
2016-10-29 18:26:05,053 - root - DEBUG - subclustering files under radius: 3
2016-10-29 18:26:05,053 - root - DEBUG - Clustered 1 files
2016-10-29 18:26:05,053 - root - DEBUG - Clustered fewer than 2 files using radius 3 -  in truncation dir /home/user1/Documents/projects/FmtA/Fmt_vik/ccp4i/AMPLE_9/ensemble_workdir/truncate_1/tlevel_100 SKIPPING
2016-10-29 18:26:05,053 - root - DEBUG - In directory /home/user1/Documents/projects/FmtA/Fmt_vik/ccp4i/AMPLE_9/ensemble_workdir/truncate_1
Running command: /home/user1/.ample/maxcluster -l /home/user1/Documents/projects/FmtA/Fmt_vik/ccp4i/AMPLE_9/ensemble_workdir/truncate_1/files.list -L 4 -rmsd -d 1000 -bb -C0
2016-10-29 18:26:05,053 - root - DEBUG - Logfile is: /home/user1/Documents/projects/FmtA/Fmt_vik/ccp4i/AMPLE_9/ensemble_workdir/truncate_1/maxcluster.log
2016-10-29 18:26:05,127 - root - DEBUG - subclustering files under radius: 1
2016-10-29 18:26:05,127 - root - DEBUG - Clustered 1 files
2016-10-29 18:26:05,127 - root - DEBUG - Clustered fewer than 2 files using radius 1 -  in truncation dir /home/user1/Documents/projects/FmtA/Fmt_vik/ccp4i/AMPLE_9/ensemble_workdir/truncate_1/tlevel_95 SKIPPING
2016-10-29 18:26:05,127 - root - DEBUG - subclustering files under radius: 2
2016-10-29 18:26:05,127 - root - DEBUG - Clustered 1 files
2016-10-29 18:26:05,127 - root - DEBUG - Clustered fewer than 2 files using radius 2 -  in truncation dir /home/user1/Documents/projects/FmtA/Fmt_vik/ccp4i/AMPLE_9/ensemble_workdir/truncate_1/tlevel_95 SKIPPING
2016-10-29 18:26:05,127 - root - DEBUG - subclustering files under radius: 3
2016-10-29 18:26:05,127 - root - DEBUG - Clustered 1 files
2016-10-29 18:26:05,127 - root - DEBUG - Clustered fewer than 2 files using radius 3 -  in truncation dir /home/user1/Documents/projects/FmtA/Fmt_vik/ccp4i/AMPLE_9/ensemble_workdir/truncate_1/tlevel_95 SKIPPING
2016-10-29 18:26:05,127 - root - DEBUG - In directory /home/user1/Documents/projects/FmtA/Fmt_vik/ccp4i/AMPLE_9/ensemble_workdir/truncate_1
Running command: /home/user1/.ample/maxcluster -l /home/user1/Documents/projects/FmtA/Fmt_vik/ccp4i/AMPLE_9/ensemble_workdir/truncate_1/files.list -L 4 -rmsd -d 1000 -bb -C0
2016-10-29 18:26:05,127 - root - DEBUG - Logfile is: /home/user1/Documents/projects/FmtA/Fmt_vik/ccp4i/AMPLE_9/ensemble_workdir/truncate_1/maxcluster.log
2016-10-29 18:26:05,193 - root - DEBUG - subclustering files under radius: 1
2016-10-29 18:26:05,193 - root - DEBUG - Clustered 1 files
2016-10-29 18:26:05,193 - root - DEBUG - Clustered fewer than 2 files using radius 1 -  in truncation dir /home/user1/Documents/projects/FmtA/Fmt_vik/ccp4i/AMPLE_9/ensemble_workdir/truncate_1/tlevel_90 SKIPPING
2016-10-29 18:26:05,193 - root - DEBUG - subclustering files under radius: 2
2016-10-29 18:26:05,193 - root - DEBUG - Clustered 1 files
2016-10-29 18:26:05,193 - root - DEBUG - Clustered fewer than 2 files using radius 2 -  in truncation dir /home/user1/Documents/projects/FmtA/Fmt_vik/ccp4i/AMPLE_9/ensemble_workdir/truncate_1/tlevel_90 SKIPPING
2016-10-29 18:26:05,193 - root - DEBUG - subclustering files under radius: 3
2016-10-29 18:26:05,193 - root - DEBUG - Clustered 1 files
2016-10-29 18:26:05,193 - root - DEBUG - Clustered fewer than 2 files using radius 3 -  in truncation dir /home/user1/Documents/projects/FmtA/Fmt_vik/ccp4i/AMPLE_9/ensemble_workdir/truncate_1/tlevel_90 SKIPPING
2016-10-29 18:26:05,194 - root - DEBUG - In directory /home/user1/Documents/projects/FmtA/Fmt_vik/ccp4i/AMPLE_9/ensemble_workdir/truncate_1
Running command: /home/user1/.ample/maxcluster -l /home/user1/Documents/projects/FmtA/Fmt_vik/ccp4i/AMPLE_9/ensemble_workdir/truncate_1/files.list -L 4 -rmsd -d 1000 -bb -C0
2016-10-29 18:26:05,194 - root - DEBUG - Logfile is: /home/user1/Documents/projects/FmtA/Fmt_vik/ccp4i/AMPLE_9/ensemble_workdir/truncate_1/maxcluster.log
2016-10-29 18:26:05,251 - root - DEBUG - subclustering files under radius: 1
2016-10-29 18:26:05,252 - root - DEBUG - Clustered 1 files
2016-10-29 18:26:05,252 - root - DEBUG - Clustered fewer than 2 files using radius 1 -  in truncation dir /home/user1/Documents/projects/FmtA/Fmt_vik/ccp4i/AMPLE_9/ensemble_workdir/truncate_1/tlevel_85 SKIPPING
2016-10-29 18:26:05,252 - root - DEBUG - subclustering files under radius: 2
2016-10-29 18:26:05,252 - root - DEBUG - Clustered 1 files
2016-10-29 18:26:05,252 - root - DEBUG - Clustered fewer than 2 files using radius 2 -  in truncation dir /home/user1/Documents/projects/FmtA/Fmt_vik/ccp4i/AMPLE_9/ensemble_workdir/truncate_1/tlevel_85 SKIPPING
2016-10-29 18:26:05,252 - root - DEBUG - subclustering files under radius: 3
2016-10-29 18:26:05,252 - root - DEBUG - Clustered 1 files
2016-10-29 18:26:05,252 - root - DEBUG - Clustered fewer than 2 files using radius 3 -  in truncation dir /home/user1/Documents/projects/FmtA/Fmt_vik/ccp4i/AMPLE_9/ensemble_workdir/truncate_1/tlevel_85 SKIPPING
2016-10-29 18:26:05,252 - root - DEBUG - In directory /home/user1/Documents/projects/FmtA/Fmt_vik/ccp4i/AMPLE_9/ensemble_workdir/truncate_1
Running command: /home/user1/.ample/maxcluster -l /home/user1/Documents/projects/FmtA/Fmt_vik/ccp4i/AMPLE_9/ensemble_workdir/truncate_1/files.list -L 4 -rmsd -d 1000 -bb -C0
2016-10-29 18:26:05,252 - root - DEBUG - Logfile is: /home/user1/Documents/projects/FmtA/Fmt_vik/ccp4i/AMPLE_9/ensemble_workdir/truncate_1/maxcluster.log
2016-10-29 18:26:05,303 - root - DEBUG - subclustering files under radius: 1
2016-10-29 18:26:05,304 - root - DEBUG - Clustered 1 files
2016-10-29 18:26:05,304 - root - DEBUG - Clustered fewer than 2 files using radius 1 -  in truncation dir /home/user1/Documents/projects/FmtA/Fmt_vik/ccp4i/AMPLE_9/ensemble_workdir/truncate_1/tlevel_80 SKIPPING
2016-10-29 18:26:05,304 - root - DEBUG - subclustering files under radius: 2
2016-10-29 18:26:05,304 - root - DEBUG - Clustered 1 files
2016-10-29 18:26:05,304 - root - DEBUG - Clustered fewer than 2 files using radius 2 -  in truncation dir /home/user1/Documents/projects/FmtA/Fmt_vik/ccp4i/AMPLE_9/ensemble_workdir/truncate_1/tlevel_80 SKIPPING
2016-10-29 18:26:05,304 - root - DEBUG - subclustering files under radius: 3
2016-10-29 18:26:05,304 - root - DEBUG - Clustered 1 files
2016-10-29 18:26:05,304 - root - DEBUG - Clustered fewer than 2 files using radius 3 -  in truncation dir /home/user1/Documents/projects/FmtA/Fmt_vik/ccp4i/AMPLE_9/ensemble_workdir/truncate_1/tlevel_80 SKIPPING
2016-10-29 18:26:05,304 - root - DEBUG - In directory /home/user1/Documents/projects/FmtA/Fmt_vik/ccp4i/AMPLE_9/ensemble_workdir/truncate_1
Running command: /home/user1/.ample/maxcluster -l /home/user1/Documents/projects/FmtA/Fmt_vik/ccp4i/AMPLE_9/ensemble_workdir/truncate_1/files.list -L 4 -rmsd -d 1000 -bb -C0
2016-10-29 18:26:05,304 - root - DEBUG - Logfile is: /home/user1/Documents/projects/FmtA/Fmt_vik/ccp4i/AMPLE_9/ensemble_workdir/truncate_1/maxcluster.log
2016-10-29 18:26:05,350 - root - DEBUG - subclustering files under radius: 1
2016-10-29 18:26:05,350 - root - DEBUG - Clustered 1 files
2016-10-29 18:26:05,350 - root - DEBUG - Clustered fewer than 2 files using radius 1 -  in truncation dir /home/user1/Documents/projects/FmtA/Fmt_vik/ccp4i/AMPLE_9/ensemble_workdir/truncate_1/tlevel_75 SKIPPING
2016-10-29 18:26:05,350 - root - DEBUG - subclustering files under radius: 2
2016-10-29 18:26:05,350 - root - DEBUG - Clustered 1 files
2016-10-29 18:26:05,350 - root - DEBUG - Clustered fewer than 2 files using radius 2 -  in truncation dir /home/user1/Documents/projects/FmtA/Fmt_vik/ccp4i/AMPLE_9/ensemble_workdir/truncate_1/tlevel_75 SKIPPING
2016-10-29 18:26:05,350 - root - DEBUG - subclustering files under radius: 3
2016-10-29 18:26:05,350 - root - DEBUG - Clustered 1 files
2016-10-29 18:26:05,350 - root - DEBUG - Clustered fewer than 2 files using radius 3 -  in truncation dir /home/user1/Documents/projects/FmtA/Fmt_vik/ccp4i/AMPLE_9/ensemble_workdir/truncate_1/tlevel_75 SKIPPING
2016-10-29 18:26:05,351 - root - DEBUG - In directory /home/user1/Documents/projects/FmtA/Fmt_vik/ccp4i/AMPLE_9/ensemble_workdir/truncate_1
Running command: /home/user1/.ample/maxcluster -l /home/user1/Documents/projects/FmtA/Fmt_vik/ccp4i/AMPLE_9/ensemble_workdir/truncate_1/files.list -L 4 -rmsd -d 1000 -bb -C0
2016-10-29 18:26:05,351 - root - DEBUG - Logfile is: /home/user1/Documents/projects/FmtA/Fmt_vik/ccp4i/AMPLE_9/ensemble_workdir/truncate_1/maxcluster.log
2016-10-29 18:26:05,389 - root - DEBUG - subclustering files under radius: 1
2016-10-29 18:26:05,389 - root - DEBUG - Clustered 1 files
2016-10-29 18:26:05,389 - root - DEBUG - Clustered fewer than 2 files using radius 1 -  in truncation dir /home/user1/Documents/projects/FmtA/Fmt_vik/ccp4i/AMPLE_9/ensemble_workdir/truncate_1/tlevel_70 SKIPPING
2016-10-29 18:26:05,389 - root - DEBUG - subclustering files under radius: 2
2016-10-29 18:26:05,390 - root - DEBUG - Clustered 1 files
2016-10-29 18:26:05,390 - root - DEBUG - Clustered fewer than 2 files using radius 2 -  in truncation dir /home/user1/Documents/projects/FmtA/Fmt_vik/ccp4i/AMPLE_9/ensemble_workdir/truncate_1/tlevel_70 SKIPPING
2016-10-29 18:26:05,390 - root - DEBUG - subclustering files under radius: 3
2016-10-29 18:26:05,390 - root - DEBUG - Clustered 1 files
2016-10-29 18:26:05,390 - root - DEBUG - Clustered fewer than 2 files using radius 3 -  in truncation dir /home/user1/Documents/projects/FmtA/Fmt_vik/ccp4i/AMPLE_9/ensemble_workdir/truncate_1/tlevel_70 SKIPPING
2016-10-29 18:26:05,390 - root - DEBUG - In directory /home/user1/Documents/projects/FmtA/Fmt_vik/ccp4i/AMPLE_9/ensemble_workdir/truncate_1
Running command: /home/user1/.ample/maxcluster -l /home/user1/Documents/projects/FmtA/Fmt_vik/ccp4i/AMPLE_9/ensemble_workdir/truncate_1/files.list -L 4 -rmsd -d 1000 -bb -C0
2016-10-29 18:26:05,390 - root - DEBUG - Logfile is: /home/user1/Documents/projects/FmtA/Fmt_vik/ccp4i/AMPLE_9/ensemble_workdir/truncate_1/maxcluster.log
2016-10-29 18:26:05,424 - root - DEBUG - subclustering files under radius: 1
2016-10-29 18:26:05,424 - root - DEBUG - Clustered 1 files
2016-10-29 18:26:05,424 - root - DEBUG - Clustered fewer than 2 files using radius 1 -  in truncation dir /home/user1/Documents/projects/FmtA/Fmt_vik/ccp4i/AMPLE_9/ensemble_workdir/truncate_1/tlevel_65 SKIPPING
2016-10-29 18:26:05,424 - root - DEBUG - subclustering files under radius: 2
2016-10-29 18:26:05,424 - root - DEBUG - Clustered 1 files
2016-10-29 18:26:05,424 - root - DEBUG - Clustered fewer than 2 files using radius 2 -  in truncation dir /home/user1/Documents/projects/FmtA/Fmt_vik/ccp4i/AMPLE_9/ensemble_workdir/truncate_1/tlevel_65 SKIPPING
2016-10-29 18:26:05,424 - root - DEBUG - subclustering files under radius: 3
2016-10-29 18:26:05,424 - root - DEBUG - Clustered 1 files
2016-10-29 18:26:05,424 - root - DEBUG - Clustered fewer than 2 files using radius 3 -  in truncation dir /home/user1/Documents/projects/FmtA/Fmt_vik/ccp4i/AMPLE_9/ensemble_workdir/truncate_1/tlevel_65 SKIPPING
2016-10-29 18:26:05,424 - root - DEBUG - In directory /home/user1/Documents/projects/FmtA/Fmt_vik/ccp4i/AMPLE_9/ensemble_workdir/truncate_1
Running command: /home/user1/.ample/maxcluster -l /home/user1/Documents/projects/FmtA/Fmt_vik/ccp4i/AMPLE_9/ensemble_workdir/truncate_1/files.list -L 4 -rmsd -d 1000 -bb -C0
2016-10-29 18:26:05,424 - root - DEBUG - Logfile is: /home/user1/Documents/projects/FmtA/Fmt_vik/ccp4i/AMPLE_9/ensemble_workdir/truncate_1/maxcluster.log
2016-10-29 18:26:05,452 - root - DEBUG - subclustering files under radius: 1
2016-10-29 18:26:05,453 - root - DEBUG - Clustered 1 files
2016-10-29 18:26:05,453 - root - DEBUG - Clustered fewer than 2 files using radius 1 -  in truncation dir /home/user1/Documents/projects/FmtA/Fmt_vik/ccp4i/AMPLE_9/ensemble_workdir/truncate_1/tlevel_60 SKIPPING
2016-10-29 18:26:05,453 - root - DEBUG - subclustering files under radius: 2
2016-10-29 18:26:05,453 - root - DEBUG - Clustered 1 files
2016-10-29 18:26:05,453 - root - DEBUG - Clustered fewer than 2 files using radius 2 -  in truncation dir /home/user1/Documents/projects/FmtA/Fmt_vik/ccp4i/AMPLE_9/ensemble_workdir/truncate_1/tlevel_60 SKIPPING
2016-10-29 18:26:05,453 - root - DEBUG - subclustering files under radius: 3
2016-10-29 18:26:05,453 - root - DEBUG - Clustered 1 files
2016-10-29 18:26:05,453 - root - DEBUG - Clustered fewer than 2 files using radius 3 -  in truncation dir /home/user1/Documents/projects/FmtA/Fmt_vik/ccp4i/AMPLE_9/ensemble_workdir/truncate_1/tlevel_60 SKIPPING
2016-10-29 18:26:05,453 - root - DEBUG - In directory /home/user1/Documents/projects/FmtA/Fmt_vik/ccp4i/AMPLE_9/ensemble_workdir/truncate_1
Running command: /home/user1/.ample/maxcluster -l /home/user1/Documents/projects/FmtA/Fmt_vik/ccp4i/AMPLE_9/ensemble_workdir/truncate_1/files.list -L 4 -rmsd -d 1000 -bb -C0
2016-10-29 18:26:05,453 - root - DEBUG - Logfile is: /home/user1/Documents/projects/FmtA/Fmt_vik/ccp4i/AMPLE_9/ensemble_workdir/truncate_1/maxcluster.log
2016-10-29 18:26:05,477 - root - DEBUG - subclustering files under radius: 1
2016-10-29 18:26:05,478 - root - DEBUG - Clustered 1 files
2016-10-29 18:26:05,478 - root - DEBUG - Clustered fewer than 2 files using radius 1 -  in truncation dir /home/user1/Documents/projects/FmtA/Fmt_vik/ccp4i/AMPLE_9/ensemble_workdir/truncate_1/tlevel_55 SKIPPING
2016-10-29 18:26:05,478 - root - DEBUG - subclustering files under radius: 2
2016-10-29 18:26:05,478 - root - DEBUG - Clustered 1 files
2016-10-29 18:26:05,478 - root - DEBUG - Clustered fewer than 2 files using radius 2 -  in truncation dir /home/user1/Documents/projects/FmtA/Fmt_vik/ccp4i/AMPLE_9/ensemble_workdir/truncate_1/tlevel_55 SKIPPING
2016-10-29 18:26:05,478 - root - DEBUG - subclustering files under radius: 3
2016-10-29 18:26:05,478 - root - DEBUG - Clustered 1 files
2016-10-29 18:26:05,478 - root - DEBUG - Clustered fewer than 2 files using radius 3 -  in truncation dir /home/user1/Documents/projects/FmtA/Fmt_vik/ccp4i/AMPLE_9/ensemble_workdir/truncate_1/tlevel_55 SKIPPING
2016-10-29 18:26:05,478 - root - DEBUG - In directory /home/user1/Documents/projects/FmtA/Fmt_vik/ccp4i/AMPLE_9/ensemble_workdir/truncate_1
Running command: /home/user1/.ample/maxcluster -l /home/user1/Documents/projects/FmtA/Fmt_vik/ccp4i/AMPLE_9/ensemble_workdir/truncate_1/files.list -L 4 -rmsd -d 1000 -bb -C0
2016-10-29 18:26:05,478 - root - DEBUG - Logfile is: /home/user1/Documents/projects/FmtA/Fmt_vik/ccp4i/AMPLE_9/ensemble_workdir/truncate_1/maxcluster.log
2016-10-29 18:26:05,499 - root - DEBUG - subclustering files under radius: 1
2016-10-29 18:26:05,499 - root - DEBUG - Clustered 1 files
2016-10-29 18:26:05,499 - root - DEBUG - Clustered fewer than 2 files using radius 1 -  in truncation dir /home/user1/Documents/projects/FmtA/Fmt_vik/ccp4i/AMPLE_9/ensemble_workdir/truncate_1/tlevel_50 SKIPPING
2016-10-29 18:26:05,499 - root - DEBUG - subclustering files under radius: 2
2016-10-29 18:26:05,499 - root - DEBUG - Clustered 1 files
2016-10-29 18:26:05,499 - root - DEBUG - Clustered fewer than 2 files using radius 2 -  in truncation dir /home/user1/Documents/projects/FmtA/Fmt_vik/ccp4i/AMPLE_9/ensemble_workdir/truncate_1/tlevel_50 SKIPPING
2016-10-29 18:26:05,499 - root - DEBUG - subclustering files under radius: 3
2016-10-29 18:26:05,499 - root - DEBUG - Clustered 1 files
2016-10-29 18:26:05,499 - root - DEBUG - Clustered fewer than 2 files using radius 3 -  in truncation dir /home/user1/Documents/projects/FmtA/Fmt_vik/ccp4i/AMPLE_9/ensemble_workdir/truncate_1/tlevel_50 SKIPPING
2016-10-29 18:26:05,500 - root - DEBUG - In directory /home/user1/Documents/projects/FmtA/Fmt_vik/ccp4i/AMPLE_9/ensemble_workdir/truncate_1
Running command: /home/user1/.ample/maxcluster -l /home/user1/Documents/projects/FmtA/Fmt_vik/ccp4i/AMPLE_9/ensemble_workdir/truncate_1/files.list -L 4 -rmsd -d 1000 -bb -C0
2016-10-29 18:26:05,500 - root - DEBUG - Logfile is: /home/user1/Documents/projects/FmtA/Fmt_vik/ccp4i/AMPLE_9/ensemble_workdir/truncate_1/maxcluster.log
2016-10-29 18:26:05,517 - root - DEBUG - subclustering files under radius: 1
2016-10-29 18:26:05,517 - root - DEBUG - Clustered 1 files
2016-10-29 18:26:05,517 - root - DEBUG - Clustered fewer than 2 files using radius 1 -  in truncation dir /home/user1/Documents/projects/FmtA/Fmt_vik/ccp4i/AMPLE_9/ensemble_workdir/truncate_1/tlevel_45 SKIPPING
2016-10-29 18:26:05,517 - root - DEBUG - subclustering files under radius: 2
2016-10-29 18:26:05,517 - root - DEBUG - Clustered 1 files
2016-10-29 18:26:05,517 - root - DEBUG - Clustered fewer than 2 files using radius 2 -  in truncation dir /home/user1/Documents/projects/FmtA/Fmt_vik/ccp4i/AMPLE_9/ensemble_workdir/truncate_1/tlevel_45 SKIPPING
2016-10-29 18:26:05,518 - root - DEBUG - subclustering files under radius: 3
2016-10-29 18:26:05,518 - root - DEBUG - Clustered 1 files
2016-10-29 18:26:05,518 - root - DEBUG - Clustered fewer than 2 files using radius 3 -  in truncation dir /home/user1/Documents/projects/FmtA/Fmt_vik/ccp4i/AMPLE_9/ensemble_workdir/truncate_1/tlevel_45 SKIPPING
2016-10-29 18:26:05,518 - root - DEBUG - In directory /home/user1/Documents/projects/FmtA/Fmt_vik/ccp4i/AMPLE_9/ensemble_workdir/truncate_1
Running command: /home/user1/.ample/maxcluster -l /home/user1/Documents/projects/FmtA/Fmt_vik/ccp4i/AMPLE_9/ensemble_workdir/truncate_1/files.list -L 4 -rmsd -d 1000 -bb -C0
2016-10-29 18:26:05,518 - root - DEBUG - Logfile is: /home/user1/Documents/projects/FmtA/Fmt_vik/ccp4i/AMPLE_9/ensemble_workdir/truncate_1/maxcluster.log
2016-10-29 18:26:05,533 - root - DEBUG - subclustering files under radius: 1
2016-10-29 18:26:05,533 - root - DEBUG - Clustered 1 files
2016-10-29 18:26:05,533 - root - DEBUG - Clustered fewer than 2 files using radius 1 -  in truncation dir /home/user1/Documents/projects/FmtA/Fmt_vik/ccp4i/AMPLE_9/ensemble_workdir/truncate_1/tlevel_40 SKIPPING
2016-10-29 18:26:05,533 - root - DEBUG - subclustering files under radius: 2
2016-10-29 18:26:05,533 - root - DEBUG - Clustered 1 files
2016-10-29 18:26:05,533 - root - DEBUG - Clustered fewer than 2 files using radius 2 -  in truncation dir /home/user1/Documents/projects/FmtA/Fmt_vik/ccp4i/AMPLE_9/ensemble_workdir/truncate_1/tlevel_40 SKIPPING
2016-10-29 18:26:05,533 - root - DEBUG - subclustering files under radius: 3
2016-10-29 18:26:05,533 - root - DEBUG - Clustered 1 files
2016-10-29 18:26:05,533 - root - DEBUG - Clustered fewer than 2 files using radius 3 -  in truncation dir /home/user1/Documents/projects/FmtA/Fmt_vik/ccp4i/AMPLE_9/ensemble_workdir/truncate_1/tlevel_40 SKIPPING
2016-10-29 18:26:05,533 - root - DEBUG - In directory /home/user1/Documents/projects/FmtA/Fmt_vik/ccp4i/AMPLE_9/ensemble_workdir/truncate_1
Running command: /home/user1/.ample/maxcluster -l /home/user1/Documents/projects/FmtA/Fmt_vik/ccp4i/AMPLE_9/ensemble_workdir/truncate_1/files.list -L 4 -rmsd -d 1000 -bb -C0
2016-10-29 18:26:05,533 - root - DEBUG - Logfile is: /home/user1/Documents/projects/FmtA/Fmt_vik/ccp4i/AMPLE_9/ensemble_workdir/truncate_1/maxcluster.log
2016-10-29 18:26:05,545 - root - DEBUG - subclustering files under radius: 1
2016-10-29 18:26:05,546 - root - DEBUG - Clustered 1 files
2016-10-29 18:26:05,546 - root - DEBUG - Clustered fewer than 2 files using radius 1 -  in truncation dir /home/user1/Documents/projects/FmtA/Fmt_vik/ccp4i/AMPLE_9/ensemble_workdir/truncate_1/tlevel_34 SKIPPING
2016-10-29 18:26:05,546 - root - DEBUG - subclustering files under radius: 2
2016-10-29 18:26:05,546 - root - DEBUG - Clustered 1 files
2016-10-29 18:26:05,546 - root - DEBUG - Clustered fewer than 2 files using radius 2 -  in truncation dir /home/user1/Documents/projects/FmtA/Fmt_vik/ccp4i/AMPLE_9/ensemble_workdir/truncate_1/tlevel_34 SKIPPING
2016-10-29 18:26:05,546 - root - DEBUG - subclustering files under radius: 3
2016-10-29 18:26:05,546 - root - DEBUG - Clustered 1 files
2016-10-29 18:26:05,546 - root - DEBUG - Clustered fewer than 2 files using radius 3 -  in truncation dir /home/user1/Documents/projects/FmtA/Fmt_vik/ccp4i/AMPLE_9/ensemble_workdir/truncate_1/tlevel_34 SKIPPING
2016-10-29 18:26:05,546 - root - DEBUG - In directory /home/user1/Documents/projects/FmtA/Fmt_vik/ccp4i/AMPLE_9/ensemble_workdir/truncate_1
Running command: /home/user1/.ample/maxcluster -l /home/user1/Documents/projects/FmtA/Fmt_vik/ccp4i/AMPLE_9/ensemble_workdir/truncate_1/files.list -L 4 -rmsd -d 1000 -bb -C0
2016-10-29 18:26:05,546 - root - DEBUG - Logfile is: /home/user1/Documents/projects/FmtA/Fmt_vik/ccp4i/AMPLE_9/ensemble_workdir/truncate_1/maxcluster.log
2016-10-29 18:26:05,563 - root - DEBUG - subclustering files under radius: 1
2016-10-29 18:26:05,563 - root - DEBUG - Clustered 1 files
2016-10-29 18:26:05,563 - root - DEBUG - Clustered fewer than 2 files using radius 1 -  in truncation dir /home/user1/Documents/projects/FmtA/Fmt_vik/ccp4i/AMPLE_9/ensemble_workdir/truncate_1/tlevel_29 SKIPPING
2016-10-29 18:26:05,563 - root - DEBUG - subclustering files under radius: 2
2016-10-29 18:26:05,563 - root - DEBUG - Clustered 1 files
2016-10-29 18:26:05,563 - root - DEBUG - Clustered fewer than 2 files using radius 2 -  in truncation dir /home/user1/Documents/projects/FmtA/Fmt_vik/ccp4i/AMPLE_9/ensemble_workdir/truncate_1/tlevel_29 SKIPPING
2016-10-29 18:26:05,564 - root - DEBUG - subclustering files under radius: 3
2016-10-29 18:26:05,564 - root - DEBUG - Clustered 1 files
2016-10-29 18:26:05,564 - root - DEBUG - Clustered fewer than 2 files using radius 3 -  in truncation dir /home/user1/Documents/projects/FmtA/Fmt_vik/ccp4i/AMPLE_9/ensemble_workdir/truncate_1/tlevel_29 SKIPPING
2016-10-29 18:26:05,564 - root - DEBUG - In directory /home/user1/Documents/projects/FmtA/Fmt_vik/ccp4i/AMPLE_9/ensemble_workdir/truncate_1
Running command: /home/user1/.ample/maxcluster -l /home/user1/Documents/projects/FmtA/Fmt_vik/ccp4i/AMPLE_9/ensemble_workdir/truncate_1/files.list -L 4 -rmsd -d 1000 -bb -C0
2016-10-29 18:26:05,564 - root - DEBUG - Logfile is: /home/user1/Documents/projects/FmtA/Fmt_vik/ccp4i/AMPLE_9/ensemble_workdir/truncate_1/maxcluster.log
2016-10-29 18:26:05,576 - root - DEBUG - subclustering files under radius: 1
2016-10-29 18:26:05,577 - root - DEBUG - Clustered 1 files
2016-10-29 18:26:05,577 - root - DEBUG - Clustered fewer than 2 files using radius 1 -  in truncation dir /home/user1/Documents/projects/FmtA/Fmt_vik/ccp4i/AMPLE_9/ensemble_workdir/truncate_1/tlevel_24 SKIPPING
2016-10-29 18:26:05,577 - root - DEBUG - subclustering files under radius: 2
2016-10-29 18:26:05,577 - root - DEBUG - Clustered 1 files
2016-10-29 18:26:05,577 - root - DEBUG - Clustered fewer than 2 files using radius 2 -  in truncation dir /home/user1/Documents/projects/FmtA/Fmt_vik/ccp4i/AMPLE_9/ensemble_workdir/truncate_1/tlevel_24 SKIPPING
2016-10-29 18:26:05,577 - root - DEBUG - subclustering files under radius: 3
2016-10-29 18:26:05,577 - root - DEBUG - Clustered 1 files
2016-10-29 18:26:05,577 - root - DEBUG - Clustered fewer than 2 files using radius 3 -  in truncation dir /home/user1/Documents/projects/FmtA/Fmt_vik/ccp4i/AMPLE_9/ensemble_workdir/truncate_1/tlevel_24 SKIPPING
2016-10-29 18:26:05,577 - root - DEBUG - In directory /home/user1/Documents/projects/FmtA/Fmt_vik/ccp4i/AMPLE_9/ensemble_workdir/truncate_1
Running command: /home/user1/.ample/maxcluster -l /home/user1/Documents/projects/FmtA/Fmt_vik/ccp4i/AMPLE_9/ensemble_workdir/truncate_1/files.list -L 4 -rmsd -d 1000 -bb -C0
2016-10-29 18:26:05,578 - root - DEBUG - Logfile is: /home/user1/Documents/projects/FmtA/Fmt_vik/ccp4i/AMPLE_9/ensemble_workdir/truncate_1/maxcluster.log
2016-10-29 18:26:05,586 - root - DEBUG - subclustering files under radius: 1
2016-10-29 18:26:05,587 - root - DEBUG - Clustered 1 files
2016-10-29 18:26:05,587 - root - DEBUG - Clustered fewer than 2 files using radius 1 -  in truncation dir /home/user1/Documents/projects/FmtA/Fmt_vik/ccp4i/AMPLE_9/ensemble_workdir/truncate_1/tlevel_19 SKIPPING
2016-10-29 18:26:05,587 - root - DEBUG - subclustering files under radius: 2
2016-10-29 18:26:05,587 - root - DEBUG - Clustered 1 files
2016-10-29 18:26:05,587 - root - DEBUG - Clustered fewer than 2 files using radius 2 -  in truncation dir /home/user1/Documents/projects/FmtA/Fmt_vik/ccp4i/AMPLE_9/ensemble_workdir/truncate_1/tlevel_19 SKIPPING
2016-10-29 18:26:05,587 - root - DEBUG - subclustering files under radius: 3
2016-10-29 18:26:05,587 - root - DEBUG - Clustered 1 files
2016-10-29 18:26:05,587 - root - DEBUG - Clustered fewer than 2 files using radius 3 -  in truncation dir /home/user1/Documents/projects/FmtA/Fmt_vik/ccp4i/AMPLE_9/ensemble_workdir/truncate_1/tlevel_19 SKIPPING
2016-10-29 18:26:05,588 - root - DEBUG - In directory /home/user1/Documents/projects/FmtA/Fmt_vik/ccp4i/AMPLE_9/ensemble_workdir/truncate_1
Running command: /home/user1/.ample/maxcluster -l /home/user1/Documents/projects/FmtA/Fmt_vik/ccp4i/AMPLE_9/ensemble_workdir/truncate_1/files.list -L 4 -rmsd -d 1000 -bb -C0
2016-10-29 18:26:05,588 - root - DEBUG - Logfile is: /home/user1/Documents/projects/FmtA/Fmt_vik/ccp4i/AMPLE_9/ensemble_workdir/truncate_1/maxcluster.log
2016-10-29 18:26:05,594 - root - DEBUG - subclustering files under radius: 1
2016-10-29 18:26:05,594 - root - DEBUG - Clustered 1 files
2016-10-29 18:26:05,594 - root - DEBUG - Clustered fewer than 2 files using radius 1 -  in truncation dir /home/user1/Documents/projects/FmtA/Fmt_vik/ccp4i/AMPLE_9/ensemble_workdir/truncate_1/tlevel_14 SKIPPING
2016-10-29 18:26:05,594 - root - DEBUG - subclustering files under radius: 2
2016-10-29 18:26:05,595 - root - DEBUG - Clustered 1 files
2016-10-29 18:26:05,595 - root - DEBUG - Clustered fewer than 2 files using radius 2 -  in truncation dir /home/user1/Documents/projects/FmtA/Fmt_vik/ccp4i/AMPLE_9/ensemble_workdir/truncate_1/tlevel_14 SKIPPING
2016-10-29 18:26:05,595 - root - DEBUG - subclustering files under radius: 3
2016-10-29 18:26:05,595 - root - DEBUG - Clustered 1 files
2016-10-29 18:26:05,595 - root - DEBUG - Clustered fewer than 2 files using radius 3 -  in truncation dir /home/user1/Documents/projects/FmtA/Fmt_vik/ccp4i/AMPLE_9/ensemble_workdir/truncate_1/tlevel_14 SKIPPING
2016-10-29 18:26:05,595 - root - DEBUG - In directory /home/user1/Documents/projects/FmtA/Fmt_vik/ccp4i/AMPLE_9/ensemble_workdir/truncate_1
Running command: /home/user1/.ample/maxcluster -l /home/user1/Documents/projects/FmtA/Fmt_vik/ccp4i/AMPLE_9/ensemble_workdir/truncate_1/files.list -L 4 -rmsd -d 1000 -bb -C0
2016-10-29 18:26:05,595 - root - DEBUG - Logfile is: /home/user1/Documents/projects/FmtA/Fmt_vik/ccp4i/AMPLE_9/ensemble_workdir/truncate_1/maxcluster.log
2016-10-29 18:26:05,600 - root - DEBUG - subclustering files under radius: 1
2016-10-29 18:26:05,600 - root - DEBUG - Clustered 1 files
2016-10-29 18:26:05,600 - root - DEBUG - Clustered fewer than 2 files using radius 1 -  in truncation dir /home/user1/Documents/projects/FmtA/Fmt_vik/ccp4i/AMPLE_9/ensemble_workdir/truncate_1/tlevel_9 SKIPPING
2016-10-29 18:26:05,600 - root - DEBUG - subclustering files under radius: 2
2016-10-29 18:26:05,600 - root - DEBUG - Clustered 1 files
2016-10-29 18:26:05,600 - root - DEBUG - Clustered fewer than 2 files using radius 2 -  in truncation dir /home/user1/Documents/projects/FmtA/Fmt_vik/ccp4i/AMPLE_9/ensemble_workdir/truncate_1/tlevel_9 SKIPPING
2016-10-29 18:26:05,600 - root - DEBUG - subclustering files under radius: 3
2016-10-29 18:26:05,601 - root - DEBUG - Clustered 1 files
2016-10-29 18:26:05,601 - root - DEBUG - Clustered fewer than 2 files using radius 3 -  in truncation dir /home/user1/Documents/projects/FmtA/Fmt_vik/ccp4i/AMPLE_9/ensemble_workdir/truncate_1/tlevel_9 SKIPPING
2016-10-29 18:26:05,601 - root - DEBUG - In directory /home/user1/Documents/projects/FmtA/Fmt_vik/ccp4i/AMPLE_9/ensemble_workdir/truncate_1
Running command: /home/user1/.ample/maxcluster -l /home/user1/Documents/projects/FmtA/Fmt_vik/ccp4i/AMPLE_9/ensemble_workdir/truncate_1/files.list -L 4 -rmsd -d 1000 -bb -C0
2016-10-29 18:26:05,601 - root - DEBUG - Logfile is: /home/user1/Documents/projects/FmtA/Fmt_vik/ccp4i/AMPLE_9/ensemble_workdir/truncate_1/maxcluster.log
2016-10-29 18:26:05,605 - root - DEBUG - subclustering files under radius: 1
2016-10-29 18:26:05,605 - root - DEBUG - Clustered 1 files
2016-10-29 18:26:05,605 - root - DEBUG - Clustered fewer than 2 files using radius 1 -  in truncation dir /home/user1/Documents/projects/FmtA/Fmt_vik/ccp4i/AMPLE_9/ensemble_workdir/truncate_1/tlevel_4 SKIPPING
2016-10-29 18:26:05,605 - root - DEBUG - subclustering files under radius: 2
2016-10-29 18:26:05,605 - root - DEBUG - Clustered 1 files
2016-10-29 18:26:05,605 - root - DEBUG - Clustered fewer than 2 files using radius 2 -  in truncation dir /home/user1/Documents/projects/FmtA/Fmt_vik/ccp4i/AMPLE_9/ensemble_workdir/truncate_1/tlevel_4 SKIPPING
2016-10-29 18:26:05,605 - root - DEBUG - subclustering files under radius: 3
2016-10-29 18:26:05,605 - root - DEBUG - Clustered 1 files
2016-10-29 18:26:05,605 - root - DEBUG - Clustered fewer than 2 files using radius 3 -  in truncation dir /home/user1/Documents/projects/FmtA/Fmt_vik/ccp4i/AMPLE_9/ensemble_workdir/truncate_1/tlevel_4 SKIPPING
2016-10-29 18:26:05,605 - root - CRITICAL - **********************************************************************
********************          AMPLE ERROR          *******************
**********************************************************************

Could not load any ensembles after running create_ensembles!

**********************************************************************

More information may be found in the debug log file: /home/user1/Documents/projects/FmtA/Fmt_vik/ccp4i/AMPLE_9/debug.log

If you believe that this is an error with AMPLE, please email: [email protected]
providing as much information as you can about how you ran the program.

Please include the debug logfile with your email: /home/user1/Documents/projects/FmtA/Fmt_vik/ccp4i/AMPLE_9/debug.log

2016-10-29 18:26:05,606 - root - DEBUG - AMPLE EXITING AT...
2016-10-29 18:26:05,606 - root - DEBUG -   File "/home/user1/Documents/destination/ccp4-6.5/bin/ample.py", line 994, in <module>
    main()
  File "/home/user1/Documents/destination/ccp4-6.5/bin/ample.py", line 899, in main
    ample_exit.exit(msg)
  File "/home/user1/Documents/destination/ccp4-6.5/share/ample/python/ample_exit.py", line 46, in exit
    ample_tb=traceback.extract_stack()

Reply via email to