Thank you Sameer. I now know - click th Advanced Search link in the RH top corner just below the Search box.. Eleanor
On Fri, 24 Jun 2022 at 15:46, Sameer Velankar <[email protected]> wrote: > Following seems to work for me - > > > https://www.ebi.ac.uk/pdbe/entry/search/index/?searchParams=%7B%22q_fasta_sequence%22:%5B%7B%22value%22:%22PNFSGNWKIIRSENFEELLKVLGVNVMLRKIAVAAASKPAVEIKQEGDTFYIKTSTTVRTTEINFKVGEEFEEQTVDGRPCKSLVKWESENKMVCEQKLLKGEGPKTSWTRELTNDGELILTMTADDVVCTRVYVRE%22,%22condition1%22:%22AND%22,%22condition2%22:%22Contains%22%7D%5D,%22resultState%22:%7B%22tabIndex%22:0,%22paginationIndex%22:1,%22perPage%22:%22100%22,%22sortBy%22:%22fasta(e_value)%20asc%22%7D%7D > <https://www.ebi.ac.uk/pdbe/entry/search/index/?searchParams=%7B%22q_fasta_sequence%22:[%7B%22value%22:%22PNFSGNWKIIRSENFEELLKVLGVNVMLRKIAVAAASKPAVEIKQEGDTFYIKTSTTVRTTEINFKVGEEFEEQTVDGRPCKSLVKWESENKMVCEQKLLKGEGPKTSWTRELTNDGELILTMTADDVVCTRVYVRE%22,%22condition1%22:%22AND%22,%22condition2%22:%22Contains%22%7D],%22resultState%22:%7B%22tabIndex%22:0,%22paginationIndex%22:1,%22perPage%22:%22100%22,%22sortBy%22:%22fasta(e_value)%20asc%22%7D%7D> > > If you replace the sequence “ > PNFSGNWKIIRSENFEELLKVLGVNVMLRKIAVAAASKPAVEIKQEGDTFYIKTSTTVRTTEINFKVGEEFEEQTVDGRPCKSLVKWESENKMVCEQKLLKGEGPKTSWTRELTNDGELILTMTADDVVCTRVYVRE > <https://www.ebi.ac.uk/pdbe/entry/search/index/?searchParams=%7B%22q_fasta_sequence%22:[%7B%22value%22:%22PNFSGNWKIIRSENFEELLKVLGVNVMLRKIAVAAASKPAVEIKQEGDTFYIKTSTTVRTTEINFKVGEEFEEQTVDGRPCKSLVKWESENKMVCEQKLLKGEGPKTSWTRELTNDGELILTMTADDVVCTRVYVRE%22,%22condition1%22:%22AND%22,%22condition2%22:%22Contains%22%7D],%22resultState%22:%7B%22tabIndex%22:0,%22paginationIndex%22:1,%22perPage%22:%22100%22,%22sortBy%22:%22fasta(e_value)%20asc%22%7D%7D>” > to what you have it should work. Be careful about the url characters either > side of the sequence. > > Sameer > > On 24 Jun 2022, at 15:41, Eleanor Dodson <[email protected]> > wrote: > > PDBe server - my long term favorite website... > > On Fri, 24 Jun 2022 at 15:40, Sameer Velankar <[email protected]> wrote: > >> Hi Eleanor >> I assume you are using PDBe service since you mention SSM or is this >> from CCP4 interface? >> Sameer >> >> On 24 Jun 2022, at 15:36, Eleanor Dodson < >> [email protected]> wrote: >> >> The pdb seems to have gone so up market I can no longer see how to submit >> a simple sequence search or rum SSM >> >> I get offered multiple options to use services I do not want to use! >> But asking for >> "sequence search" or Search sequences" gives lots and lots of >> non-intuitive choices! >> Grrr >> Eleanor >> >> Any advice? >> >> ------------------------------ >> >> To unsubscribe from the CCP4BB list, click the following link: >> https://www.jiscmail.ac.uk/cgi-bin/WA-JISC.exe?SUBED1=CCP4BB&A=1 >> >> >> > ######################################################################## To unsubscribe from the CCP4BB list, click the following link: https://www.jiscmail.ac.uk/cgi-bin/WA-JISC.exe?SUBED1=CCP4BB&A=1 This message was issued to members of www.jiscmail.ac.uk/CCP4BB, a mailing list hosted by www.jiscmail.ac.uk, terms & conditions are available at https://www.jiscmail.ac.uk/policyandsecurity/
