Thank you Sameer.
I now know -
click th
Advanced Search link
in the RH top corner just below the Search box..
 Eleanor

On Fri, 24 Jun 2022 at 15:46, Sameer Velankar <[email protected]> wrote:

> Following seems to work for me -
>
>
> https://www.ebi.ac.uk/pdbe/entry/search/index/?searchParams=%7B%22q_fasta_sequence%22:%5B%7B%22value%22:%22PNFSGNWKIIRSENFEELLKVLGVNVMLRKIAVAAASKPAVEIKQEGDTFYIKTSTTVRTTEINFKVGEEFEEQTVDGRPCKSLVKWESENKMVCEQKLLKGEGPKTSWTRELTNDGELILTMTADDVVCTRVYVRE%22,%22condition1%22:%22AND%22,%22condition2%22:%22Contains%22%7D%5D,%22resultState%22:%7B%22tabIndex%22:0,%22paginationIndex%22:1,%22perPage%22:%22100%22,%22sortBy%22:%22fasta(e_value)%20asc%22%7D%7D
> <https://www.ebi.ac.uk/pdbe/entry/search/index/?searchParams=%7B%22q_fasta_sequence%22:[%7B%22value%22:%22PNFSGNWKIIRSENFEELLKVLGVNVMLRKIAVAAASKPAVEIKQEGDTFYIKTSTTVRTTEINFKVGEEFEEQTVDGRPCKSLVKWESENKMVCEQKLLKGEGPKTSWTRELTNDGELILTMTADDVVCTRVYVRE%22,%22condition1%22:%22AND%22,%22condition2%22:%22Contains%22%7D],%22resultState%22:%7B%22tabIndex%22:0,%22paginationIndex%22:1,%22perPage%22:%22100%22,%22sortBy%22:%22fasta(e_value)%20asc%22%7D%7D>
>
> If you replace the sequence “
> PNFSGNWKIIRSENFEELLKVLGVNVMLRKIAVAAASKPAVEIKQEGDTFYIKTSTTVRTTEINFKVGEEFEEQTVDGRPCKSLVKWESENKMVCEQKLLKGEGPKTSWTRELTNDGELILTMTADDVVCTRVYVRE
> <https://www.ebi.ac.uk/pdbe/entry/search/index/?searchParams=%7B%22q_fasta_sequence%22:[%7B%22value%22:%22PNFSGNWKIIRSENFEELLKVLGVNVMLRKIAVAAASKPAVEIKQEGDTFYIKTSTTVRTTEINFKVGEEFEEQTVDGRPCKSLVKWESENKMVCEQKLLKGEGPKTSWTRELTNDGELILTMTADDVVCTRVYVRE%22,%22condition1%22:%22AND%22,%22condition2%22:%22Contains%22%7D],%22resultState%22:%7B%22tabIndex%22:0,%22paginationIndex%22:1,%22perPage%22:%22100%22,%22sortBy%22:%22fasta(e_value)%20asc%22%7D%7D>”
> to what you have it should work. Be careful about the url characters either
> side of the sequence.
>
> Sameer
>
> On 24 Jun 2022, at 15:41, Eleanor Dodson <[email protected]>
> wrote:
>
> PDBe server - my long term favorite website...
>
> On Fri, 24 Jun 2022 at 15:40, Sameer Velankar <[email protected]> wrote:
>
>> Hi Eleanor
>>   I assume you are using PDBe service since you mention SSM or is this
>> from CCP4 interface?
>> Sameer
>>
>> On 24 Jun 2022, at 15:36, Eleanor Dodson <
>> [email protected]> wrote:
>>
>> The pdb seems to have gone so up market I can no longer see how to submit
>> a simple sequence search or rum SSM
>>
>> I get offered multiple options to use services I do not want to use!
>> But asking for
>> "sequence search" or Search sequences" gives lots and lots of
>> non-intuitive choices!
>> Grrr
>> Eleanor
>>
>> Any advice?
>>
>> ------------------------------
>>
>> To unsubscribe from the CCP4BB list, click the following link:
>> https://www.jiscmail.ac.uk/cgi-bin/WA-JISC.exe?SUBED1=CCP4BB&A=1
>>
>>
>>
>

########################################################################

To unsubscribe from the CCP4BB list, click the following link:
https://www.jiscmail.ac.uk/cgi-bin/WA-JISC.exe?SUBED1=CCP4BB&A=1

This message was issued to members of www.jiscmail.ac.uk/CCP4BB, a mailing list 
hosted by www.jiscmail.ac.uk, terms & conditions are available at 
https://www.jiscmail.ac.uk/policyandsecurity/

Reply via email to