To whom it may concern,
I am currently working with CCP4 version 8.0.016 on an Ubuntu 22.04 system. In
my efforts to follow the guidelines provided in the documentation
(https://ccp4i2.gitlab.io/rstdocs/i2run/i2run.html), I have encountered an
issue. Specifically, I have encountered a problem while trying to run
"buccaneer_build_refine_mr." It appears that I need to provide the "--ASUIN"
parameter. When attempting to run the "i2run ProvideAsuContents" command to get
the asymmetric unit content files, I encountered an error.
Here are the commands I used:
/home/programs/ccp4-8.0/lib/python3.7/site-packages/ccp4i2/bin/i2run
ProvideAsuContents \
--ASU_CONTENT \
sequence=MAHHHHHMFRIVVGLGKSGMSLVRYLARRGLPFAVVDTRENPPELATLRAQYPQVEV \
nCopies=1 \
polymerType=PROTEIN \
name=8T1A_1_Chains \
--noDb
The result I received is as follows:
CCP4 /home/xin/programs/ccp4-8.0
ccp4i2 version 1.1.0
ccp4i2 source revision 6539
Starting <class 'core.CCP4DataManager.CDataManager'> 0.0005092620849609375
Processing command ProvideAsuContents
['/home/programs/ccp4-8.0/lib/python3.7/site-packages/ccp4i2/core/CCP4I2Runner.py',
'ProvideAsuContents']
Processing command noDb True
Processing command taskName ProvideAsuContents
Processing command jobDirectory /home/xin/0109
Processing command ASU_CONTENT
[['sequence=MAHHHHHMFRIVVGLGKSGMSLVRYLARRGLPFAVVDTRENPPELATLRAQYPQVEV',
'nCopies=1', 'polymerType=PROTEIN', 'name=8T1A_1_Chains']]
Failed adding program version to parent job None None
Error in wrapper ProvideAsuContents: -ERROR- ProvideAsuContents:48 Error in
wrapper ProvideAsuContents:: Error in the plugin script startProcess
I would appreciate your guidance on how to address this issue.
Best regards,
Xin
########################################################################
To unsubscribe from the CCP4BB list, click the following link:
https://www.jiscmail.ac.uk/cgi-bin/WA-JISC.exe?SUBED1=CCP4BB&A=1
This message was issued to members of www.jiscmail.ac.uk/CCP4BB, a mailing list
hosted by www.jiscmail.ac.uk, terms & conditions are available at
https://www.jiscmail.ac.uk/policyandsecurity/
