Modified:
websites/production/tapestry/content/page-and-component-classes-faq.html
==============================================================================
--- websites/production/tapestry/content/page-and-component-classes-faq.html
(original)
+++ websites/production/tapestry/content/page-and-component-classes-faq.html
Sun Nov 8 17:21:51 2015
@@ -67,7 +67,30 @@
</div>
<div id="content">
-<div id="ConfluenceContent"><h2
id="PageAndComponentClassesFAQ-PageAndComponentClasses">Page And Component
Classes</h2><p>Main article: <a shape="rect"
href="component-classes.html">Component Classes</a></p><h3
id="PageAndComponentClassesFAQ-What'sthedifferencebetweenapageandacomponent?">What's
the difference between a page and a component?</h3><p>There's very little
difference between the two. Pages classes must be in the
<em>root-package</em>.<code>pages</code> package; components must be in the
<em>root-package</em>.<code>components</code>. Pages may provide event handlers
for certain page-specific events (such as activate and passivate). Components
may have parameters.</p><p>Other than that, they are more equal than they are
different. They may have templates or may render themselves in code (pages
usually have a template, components are more likely to render only in
code).</p><p>The major difference is that Tapestry page templates may be stored
in the web context directory, as
if they were static files (they can't be accessed from the client however; a
specific rule prevents access to files with the <code>.tml</code>
extension).</p><div class="confluence-information-macro
confluence-information-macro-warning"><span class="aui-icon aui-icon-small
aui-iconfont-error confluence-information-macro-icon"></span><div
class="confluence-information-macro-body"><p>It is possible that this feature
may be removed in a later release. It is preferred that page templates be
stored on the classpath, like component templates.</p></div></div><h3
id="PageAndComponentClassesFAQ-HowdoIstoremypageclassesinadifferentpackage?">How
do I store my page classes in a different package?</h3><p>Tapestry is very
rigid here; you can't. Page classes must go in
<em>root-package</em>.<code>pages</code>, component classes in
<em>root-package</em>.<code>components</code>, etc.</p><p>You are allowed to
create sub-packages, to help organize your code better and more logically. For
example, you
might have <em>root-package</em>.<code>pages.account.ViewAccount</code>, which
would have the page name "account/viewaccount". (<span style="line-height:
1.4285715;">Tapestry would also create an alias "account/view", by stripping
off the redundant "account" suffix. Either name is equally valid in your code,
and Tapestry will use the shorter name, "account/view" in
URLs.)</span></p><p>In addition, it is possible to define additional root
packages for the application:</p><div class="code panel pdl"
style="border-width: 1px;"><div class="codeContent panelContent pdl">
+<div id="ConfluenceContent">
+<div class="atb-scrollbar-macro">
+ <div class="prev">
+ <a shape="rect" href="templating-and-markup-faq.html" rel="prev">
+ <span class="aui-icon aui-icon-small
atb-icon-arrow-left">Previous</span>
+ <span class="title">Templating and Markup
FAQ</span>
+ </a>
+
+ </div>
+ <div class="parent">
+ <a shape="rect" href="frequently-asked-questions.html"
rel="parent">
+ <span class="aui-icon
aui-icon-small atb-icon-arrow-up">Up</span>
+ <span class="title">Frequently Asked
Questions</span>
+ </a>
+
+ </div>
+ <div class="next">
+ <a shape="rect" href="forms-and-form-components-faq.html" rel="next">
+ <span class="title">Forms and Form Components FAQ</span>
+ <span class="aui-icon aui-icon-small
atb-icon-arrow-right">Next</span>
+ </a>
+
+ </div>
+</div><h2 id="PageAndComponentClassesFAQ-PageAndComponentClasses">Page And
Component Classes</h2><p>Main article: <a shape="rect"
href="component-classes.html">Component Classes</a></p><h3
id="PageAndComponentClassesFAQ-What'sthedifferencebetweenapageandacomponent?">What's
the difference between a page and a component?</h3><p>There's very little
difference between the two. Pages classes must be in the
<em>root-package</em>.<code>pages</code> package; components must be in the
<em>root-package</em>.<code>components</code>. Pages may provide event handlers
for certain page-specific events (such as activate and passivate). Components
may have parameters.</p><p>Other than that, they are more equal than they are
different. They may have templates or may render themselves in code (pages
usually have a template, components are more likely to render only in
code).</p><p>The major difference is that Tapestry page templates may be stored
in the web context directory, as if they were static fi
les (they can't be accessed from the client however; a specific rule prevents
access to files with the <code>.tml</code> extension).</p><div
class="confluence-information-macro confluence-information-macro-warning"><span
class="aui-icon aui-icon-small aui-iconfont-error
confluence-information-macro-icon"></span><div
class="confluence-information-macro-body"><p>It is possible that this feature
may be removed in a later release. It is preferred that page templates be
stored on the classpath, like component templates.</p></div></div><h3
id="PageAndComponentClassesFAQ-HowdoIstoremypageclassesinadifferentpackage?">How
do I store my page classes in a different package?</h3><p>Tapestry is very
rigid here; you can't. Page classes must go in
<em>root-package</em>.<code>pages</code>, component classes in
<em>root-package</em>.<code>components</code>, etc.</p><p>You are allowed to
create sub-packages, to help organize your code better and more logically. For
example, you might have <em>root-pa
ckage</em>.<code>pages.account.ViewAccount</code>, which would have the page
name "account/viewaccount". (<span style="line-height: 1.4285715;">Tapestry
would also create an alias "account/view", by stripping off the redundant
"account" suffix. Either name is equally valid in your code, and Tapestry will
use the shorter name, "account/view" in URLs.)</span></p><p>In addition, it is
possible to define additional root packages for the application:</p><div
class="code panel pdl" style="border-width: 1px;"><div class="codeContent
panelContent pdl">
<pre class="brush: java; gutter: true; theme: Default"
style="font-size:12px;">public static void
contributeComponentClassResolver(Configuration<LibraryMapping>
configuration) {
configuration.add(new LibraryMapping("", "com.example.app.tasks"));
configuration.add(new LibraryMapping("", "com.example.app.chat"));
@@ -100,13 +123,13 @@ public class DBImage
-<span class="gliffy-container" id="gliffy-container-23527573-1598"
data-fullwidth="750" data-ceoid="23335008"
data-edit="${diagramEditLink.getLinkUrl()}"
data-full="${diagramZoomLink.getLinkUrl()}" data-filename="Class Loaders">
+<span class="gliffy-container" id="gliffy-container-23527573-4485"
data-fullwidth="750" data-ceoid="23335008"
data-edit="${diagramEditLink.getLinkUrl()}"
data-full="${diagramZoomLink.getLinkUrl()}" data-filename="Class Loaders">
- <map id="gliffy-map-23527573-5296" name="gliffy-map-23527573-5296"></map>
+ <map id="gliffy-map-23527573-7820" name="gliffy-map-23527573-7820"></map>
- <img class="gliffy-image" id="gliffy-image-23527573-1598" width="750"
height="425" data-full-width="750" data-full-height="425"
src="https://cwiki.apache.org/confluence/download/attachments/23335008/Class%20Loaders.png?version=4&modificationDate=1283534469000&api=v2";
alt="Class Loaders" usemap="#gliffy-map-23527573-5296">
+ <img class="gliffy-image" id="gliffy-image-23527573-4485" width="750"
height="425" data-full-width="750" data-full-height="425"
src="https://cwiki.apache.org/confluence/download/attachments/23335008/Class%20Loaders.png?version=4&modificationDate=1283534469000&api=v2";
alt="Class Loaders" usemap="#gliffy-map-23527573-7820">
- <map class="gliffy-dynamic" id="gliffy-dynamic-map-23527573-1598"
name="gliffy-dynamic-map-23527573-1598"></map>
+ <map class="gliffy-dynamic" id="gliffy-dynamic-map-23527573-4485"
name="gliffy-dynamic-map-23527573-4485"></map>
</span>
@@ -117,7 +140,30 @@ public class DBImage
. . .
}
</pre>
-</div></div><p>The compiler will catch a misspelling of the constant
<code>SUCCESS</code>. Likewise, local constants can be defined for key
components, such as "loginForm".</p><div class="confluence-information-macro
confluence-information-macro-information"><span class="aui-icon aui-icon-small
aui-iconfont-info confluence-information-macro-icon"></span><div
class="confluence-information-macro-body"><p>Ultimately, it's developer choice.
HLS prefers the method naming conventions in nearly all cases, especially
prototypes and demos, but can see that in some projects and some teams, an
annotation-only approach is best.</p></div></div><h3
id="PageAndComponentClassesFAQ-WhydoIhavetoinjectapage?Whycan'tIjustcreateoneusingnew?">Why
do I have to inject a page? Why can't I just create one using
new?</h3><p>Tapestry tranforms your class at runtime. It tends to build a large
constructor for the class instance. Further, an instance of the class is
useless by itself, it must be wired together wi
th its template and its sub-components.</p><p>On top of that, Tapestry keeps
just once instance of each page in memory (since 5.2). It reworks the bytecode
of the components so that a single instance can be shared across multiple
request handling
threads.</p><p>____</p><p> </p><p> </p><p></p><p></p><p></p><p></p><p></p><p></p><p></p><p><table
class="Footnotes" style="width: 100%; border:none;" cellspacing="0"
cellpadding="0" summary="This table contains one or more notes for references
made elsewhere on the page."><caption
class="accessibility">Footnotes</caption><thead class="accessibility"><tr
class="accessibility"><th colspan="1" rowspan="1" class="accessibility"
id="footnote-th1">Reference</th><th colspan="1" rowspan="1"
class="accessibility"
id="footnote-th2">Notes</th></tr></thead><tbody></tbody></table></p><p></p><p></p><p></p><p></p><p></p><p></p><p></p><p> </p><p> </p></div>
+</div></div><p>The compiler will catch a misspelling of the constant
<code>SUCCESS</code>. Likewise, local constants can be defined for key
components, such as "loginForm".</p><div class="confluence-information-macro
confluence-information-macro-information"><span class="aui-icon aui-icon-small
aui-iconfont-info confluence-information-macro-icon"></span><div
class="confluence-information-macro-body"><p>Ultimately, it's developer choice.
HLS prefers the method naming conventions in nearly all cases, especially
prototypes and demos, but can see that in some projects and some teams, an
annotation-only approach is best.</p></div></div><h3
id="PageAndComponentClassesFAQ-WhydoIhavetoinjectapage?Whycan'tIjustcreateoneusingnew?">Why
do I have to inject a page? Why can't I just create one using
new?</h3><p>Tapestry tranforms your class at runtime. It tends to build a large
constructor for the class instance. Further, an instance of the class is
useless by itself, it must be wired together wi
th its template and its sub-components.</p><p>On top of that, Tapestry keeps
just once instance of each page in memory (since 5.2). It reworks the bytecode
of the components so that a single instance can be shared across multiple
request handling threads.</p>
+<div class="atb-scrollbar-macro">
+ <div class="prev">
+ <a shape="rect" href="templating-and-markup-faq.html" rel="prev">
+ <span class="aui-icon aui-icon-small
atb-icon-arrow-left">Previous</span>
+ <span class="title">Templating and Markup
FAQ</span>
+ </a>
+
+ </div>
+ <div class="parent">
+ <a shape="rect" href="frequently-asked-questions.html"
rel="parent">
+ <span class="aui-icon
aui-icon-small atb-icon-arrow-up">Up</span>
+ <span class="title">Frequently Asked
Questions</span>
+ </a>
+
+ </div>
+ <div class="next">
+ <a shape="rect" href="forms-and-form-components-faq.html" rel="next">
+ <span class="title">Forms and Form Components FAQ</span>
+ <span class="aui-icon aui-icon-small
atb-icon-arrow-right">Next</span>
+ </a>
+
+ </div>
+</div><p>____</p><p> </p><p> </p><p></p><p></p><p></p><p></p><p></p><p></p><p></p><p><table
class="Footnotes" style="width: 100%; border:none;" cellspacing="0"
cellpadding="0" summary="This table contains one or more notes for references
made elsewhere on the page."><caption
class="accessibility">Footnotes</caption><thead class="accessibility"><tr
class="accessibility"><th colspan="1" rowspan="1" class="accessibility"
id="footnote-th1">Reference</th><th colspan="1" rowspan="1"
class="accessibility"
id="footnote-th2">Notes</th></tr></thead><tbody></tbody></table></p><p></p><p></p><p></p><p></p><p></p><p></p><p></p><p> </p><p> </p></div>
</div>
<div class="clearer"></div>
Modified: websites/production/tapestry/content/release-notes-50.html
==============================================================================
--- websites/production/tapestry/content/release-notes-50.html (original)
+++ websites/production/tapestry/content/release-notes-50.html Sun Nov 8
17:21:51 2015
@@ -67,17 +67,40 @@
</div>
<div id="content">
-<div id="ConfluenceContent">
+<div id="ConfluenceContent">
+<div class="atb-scrollbar-macro">
+ <div class="prev">
+ <a shape="rect" href="how-to-upgrade.html" rel="prev">
+ <span class="aui-icon aui-icon-small
atb-icon-arrow-left">Previous</span>
+ <span class="title">How to Upgrade</span>
+ </a>
+
+ </div>
+ <div class="parent">
+ <a shape="rect" href="release-notes.html" rel="parent">
+ <span class="aui-icon
aui-icon-small atb-icon-arrow-up">Up</span>
+ <span class="title">Release
Notes</span>
+ </a>
+
+ </div>
+ <div class="next">
+ <a shape="rect" href="release-notes-51.html" rel="next">
+ <span class="title">Release Notes 5.1</span>
+ <span class="aui-icon aui-icon-small
atb-icon-arrow-right">Next</span>
+ </a>
+
+ </div>
+</div>
<p>This is the consolidated list of changes between Tapestry versions 5.0.3
and 5.0.19. Before upgrading, be sure to review the <a shape="rect"
href="how-to-upgrade.html">How to Upgrade</a> instructions.</p>
<p><strong>Contents</strong></p>
<style type="text/css">/*<![CDATA[*/
-div.rbtoc1437340848275 {padding: 0px;}
-div.rbtoc1437340848275 ul {list-style: disc;margin-left: 0px;padding-left:
5px;}
-div.rbtoc1437340848275 li {margin-left: 0px;padding-left: 0px;}
+div.rbtoc1447003262602 {padding: 0px;}
+div.rbtoc1447003262602 ul {list-style: disc;margin-left: 0px;padding-left:
5px;}
+div.rbtoc1447003262602 li {margin-left: 0px;padding-left: 0px;}
-/*]]>*/</style><div class="toc-macro rbtoc1437340848275">
+/*]]>*/</style><div class="toc-macro rbtoc1447003262602">
<ul class="toc-indentation"><li><a shape="rect"
href="#ReleaseNotes5.0-TapestryVersion5.0.19">Tapestry Version
5.0.19</a></li><li><a shape="rect"
href="#ReleaseNotes5.0-TapestryVersion5.0.18">Tapestry Version
5.0.18</a></li><li><a shape="rect"
href="#ReleaseNotes5.0-TapestryVersion5.0.17">Tapestry Version
5.0.17</a></li><li><a shape="rect"
href="#ReleaseNotes5.0-TapestryVersion5.0.16">Tapestry Version
5.0.16</a></li><li><a shape="rect"
href="#ReleaseNotes5.0-TapestryVersion5.0.15">Tapestry Version
5.0.15</a></li><li><a shape="rect"
href="#ReleaseNotes5.0-TapestryVersion5.0.14">Tapestry Version
5.0.14</a></li><li><a shape="rect"
href="#ReleaseNotes5.0-TapestryVersion5.0.13">Tapestry Version
5.0.13</a></li><li><a shape="rect"
href="#ReleaseNotes5.0-TapestryVersion5.0.12">Tapestry Version
5.0.12</a></li><li><a shape="rect"
href="#ReleaseNotes5.0-TapestryVersion5.0.11">Tapestry Version
5.0.11</a></li><li><a shape="rect"
href="#ReleaseNotes5.0-TapestryVersion5.0.10">Tapestry Version 5.0.
10</a></li><li><a shape="rect"
href="#ReleaseNotes5.0-TapestryVersion5.0.9">Tapestry Version
5.0.9</a></li><li><a shape="rect"
href="#ReleaseNotes5.0-TapestryVersion5.0.8">Tapestry Version
5.0.8</a></li><li><a shape="rect"
href="#ReleaseNotes5.0-TapestryVersion5.0.7">Tapestry Version
5.0.7</a></li><li><a shape="rect"
href="#ReleaseNotes5.0-TapestryVersion5.0.6">Tapestry Version
5.0.6</a></li><li><a shape="rect"
href="#ReleaseNotes5.0-TapestryVersion5.0.5">Tapestry Version
5.0.5</a></li><li><a shape="rect"
href="#ReleaseNotes5.0-TapestryVersion5.0.4">Tapestry Version
5.0.4</a></li><li><a shape="rect"
href="#ReleaseNotes5.0-TapestryVersion5.0.3">Tapestry Version
5.0.3</a></li></ul>
</div>
@@ -421,7 +444,31 @@ div.rbtoc1437340848275 li {margin-left:
<ul><li><a shape="rect" class="external-link"
href="https://issues.apache.org/jira/browse/TAPESTRY-1276";>TAPESTRY-1276</a>
– If component should include an optional negate parameter</li><li><a
shape="rect" class="external-link"
href="https://issues.apache.org/jira/browse/TAPESTRY-1284";>TAPESTRY-1284</a>
– Tapestry Spring integration module</li><li><a shape="rect"
class="external-link"
href="https://issues.apache.org/jira/browse/TAPESTRY-1292";>TAPESTRY-1292</a>
– Allow lists to be used as select models</li><li><a shape="rect"
class="external-link"
href="https://issues.apache.org/jira/browse/TAPESTRY-1302";>TAPESTRY-1302</a>
– JavaScript support</li><li><a shape="rect" class="external-link"
href="https://issues.apache.org/jira/browse/TAPESTRY-1311";>TAPESTRY-1311</a>
– Identify type of component via tag element name in templates</li><li><a
shape="rect" class="external-link"
href="https://issues.apache.org/jira/browse/TAPESTRY-1319";>TAPESTRY-1319</a>
–
tapestry.InfrastructureOverrides is not yet implemented</li><li><a
shape="rect" class="external-link"
href="https://issues.apache.org/jira/browse/TAPESTRY-1325";>TAPESTRY-1325</a>
– Add an "asset:" object provider, to simplfy injecting assets into
services</li><li><a shape="rect" class="external-link"
href="https://issues.apache.org/jira/browse/TAPESTRY-1341";>TAPESTRY-1341</a>
– Allow service builders named "build" and determine service id from the
result type</li></ul>
-</div>
+
+
+<div class="atb-scrollbar-macro">
+ <div class="prev">
+ <a shape="rect" href="how-to-upgrade.html" rel="prev">
+ <span class="aui-icon aui-icon-small
atb-icon-arrow-left">Previous</span>
+ <span class="title">How to Upgrade</span>
+ </a>
+
+ </div>
+ <div class="parent">
+ <a shape="rect" href="release-notes.html" rel="parent">
+ <span class="aui-icon
aui-icon-small atb-icon-arrow-up">Up</span>
+ <span class="title">Release
Notes</span>
+ </a>
+
+ </div>
+ <div class="next">
+ <a shape="rect" href="release-notes-51.html" rel="next">
+ <span class="title">Release Notes 5.1</span>
+ <span class="aui-icon aui-icon-small
atb-icon-arrow-right">Next</span>
+ </a>
+
+ </div>
+</div></div>
</div>
<div class="clearer"></div>
Modified: websites/production/tapestry/content/release-notes-51.html
==============================================================================
--- websites/production/tapestry/content/release-notes-51.html (original)
+++ websites/production/tapestry/content/release-notes-51.html Sun Nov 8
17:21:51 2015
@@ -67,17 +67,40 @@
</div>
<div id="content">
-<div id="ConfluenceContent">
+<div id="ConfluenceContent">
+<div class="atb-scrollbar-macro">
+ <div class="prev">
+ <a shape="rect" href="release-notes-50.html" rel="prev">
+ <span class="aui-icon aui-icon-small
atb-icon-arrow-left">Previous</span>
+ <span class="title">Release Notes 5.0</span>
+ </a>
+
+ </div>
+ <div class="parent">
+ <a shape="rect" href="release-notes.html" rel="parent">
+ <span class="aui-icon
aui-icon-small atb-icon-arrow-up">Up</span>
+ <span class="title">Release
Notes</span>
+ </a>
+
+ </div>
+ <div class="next">
+ <a shape="rect" href="release-notes-52.html" rel="next">
+ <span class="title">Release Notes 5.2</span>
+ <span class="aui-icon aui-icon-small
atb-icon-arrow-right">Next</span>
+ </a>
+
+ </div>
+</div>
<p>This is the consolidated list of changes between Tapestry versions 5.0 and
5.1. Before upgrading, be sure to review the <a shape="rect"
href="how-to-upgrade.html">How to Upgrade</a> instructions.</p>
<p><strong>Contents</strong></p>
<style type="text/css">/*<![CDATA[*/
-div.rbtoc1437340791870 {padding: 0px;}
-div.rbtoc1437340791870 ul {list-style: disc;margin-left: 0px;}
-div.rbtoc1437340791870 li {margin-left: 0px;padding-left: 0px;}
+div.rbtoc1447003195363 {padding: 0px;}
+div.rbtoc1447003195363 ul {list-style: disc;margin-left: 0px;}
+div.rbtoc1447003195363 li {margin-left: 0px;padding-left: 0px;}
-/*]]>*/</style><div class="toc-macro rbtoc1437340791870">
+/*]]>*/</style><div class="toc-macro rbtoc1447003195363">
<ul class="toc-indentation"><li><a shape="rect"
href="#ReleaseNotes5.1-TapestryVersion5.1.0.5">Tapestry Version
5.1.0.5</a></li><li><a shape="rect"
href="#ReleaseNotes5.1-TapestryVersion5.1.0.4">Tapestry Version
5.1.0.4</a></li><li><a shape="rect"
href="#ReleaseNotes5.1-TapestryVersion5.1.0.3">Tapestry Version
5.1.0.3</a></li><li><a shape="rect"
href="#ReleaseNotes5.1-TapestryVersion5.1.0.2">Tapestry Version
5.1.0.2</a></li><li><a shape="rect"
href="#ReleaseNotes5.1-TapestryVersion5.1.0.1">Tapestry Version
5.1.0.1</a></li><li><a shape="rect"
href="#ReleaseNotes5.1-TapestryVersion5.1.0.0">Tapestry Version
5.1.0.0</a></li></ul>
</div>
@@ -207,7 +230,31 @@ div.rbtoc1437340791870 li {margin-left:
<ul><li><a shape="rect" class="external-link"
href="https://issues.apache.org/jira/browse/TAP5-372";>TAP5-372</a> –
Merge changes from 5.0.16 --> 5.0.17 into trunk (5.1)</li><li><a
shape="rect" class="external-link"
href="https://issues.apache.org/jira/browse/TAP5-379";>TAP5-379</a> – Add
the Ars Machina Project to the list of Tapestry 5-related packages</li><li><a
shape="rect" class="external-link"
href="https://issues.apache.org/jira/browse/TAP5-381";>TAP5-381</a> –
Documentation talks about a "tapestry.charset" when there's no such
configuration documented</li><li><a shape="rect" class="external-link"
href="https://issues.apache.org/jira/browse/TAP5-480";>TAP5-480</a> –
Upgrade Surefire Plugin and TestNG dependencies to latest version (2.4.3 and
5.8, respectively)</li><li><a shape="rect" class="external-link"
href="https://issues.apache.org/jira/browse/TAP5-493";>TAP5-493</a> –
Translate StructureStrings#original-child-component</li><li><a shape="rect"
class="external-link"
href="https://issues.apache.org/jira/browse/TAP5-494";>TAP5-494</a> –
Downgrade maven-site-plugin from 2.0-beta-6 to 2.0-beta-5 because we prefer a
site that actually works</li></ul>
-</div>
+
+
+<div class="atb-scrollbar-macro">
+ <div class="prev">
+ <a shape="rect" href="release-notes-50.html" rel="prev">
+ <span class="aui-icon aui-icon-small
atb-icon-arrow-left">Previous</span>
+ <span class="title">Release Notes 5.0</span>
+ </a>
+
+ </div>
+ <div class="parent">
+ <a shape="rect" href="release-notes.html" rel="parent">
+ <span class="aui-icon
aui-icon-small atb-icon-arrow-up">Up</span>
+ <span class="title">Release
Notes</span>
+ </a>
+
+ </div>
+ <div class="next">
+ <a shape="rect" href="release-notes-52.html" rel="next">
+ <span class="title">Release Notes 5.2</span>
+ <span class="aui-icon aui-icon-small
atb-icon-arrow-right">Next</span>
+ </a>
+
+ </div>
+</div></div>
</div>
<div class="clearer"></div>
Modified: websites/production/tapestry/content/release-notes-52.html
==============================================================================
--- websites/production/tapestry/content/release-notes-52.html (original)
+++ websites/production/tapestry/content/release-notes-52.html Sun Nov 8
17:21:51 2015
@@ -68,12 +68,35 @@
</div>
<div id="content">
-<div id="ConfluenceContent"><p>This is the consolidated list of changes
between Tapestry versions 5.1 and 5.2. To upgrade from 5.1 to 5.2, most users
will be able to just update the Maven dependency in their POM file (or <a
shape="rect" href="download.html">download</a> the new JAR file) and the new
version will just work. However, please read carefully below before upgrading,
and also review the <a shape="rect" href="how-to-upgrade.html">How to
Upgrade</a> instructions.</p><p><strong>Contents</strong></p><p><style
type="text/css">/*<![CDATA[*/
-div.rbtoc1437340824369 {padding: 0px;}
-div.rbtoc1437340824369 ul {list-style: disc;margin-left: 0px;}
-div.rbtoc1437340824369 li {margin-left: 0px;padding-left: 0px;}
+<div id="ConfluenceContent">
+<div class="atb-scrollbar-macro">
+ <div class="prev">
+ <a shape="rect" href="release-notes-51.html" rel="prev">
+ <span class="aui-icon aui-icon-small
atb-icon-arrow-left">Previous</span>
+ <span class="title">Release Notes 5.1</span>
+ </a>
+
+ </div>
+ <div class="parent">
+ <a shape="rect" href="release-notes.html" rel="parent">
+ <span class="aui-icon
aui-icon-small atb-icon-arrow-up">Up</span>
+ <span class="title">Release
Notes</span>
+ </a>
+
+ </div>
+ <div class="next">
+ <a shape="rect" href="release-notes-53.html" rel="next">
+ <span class="title">Release Notes 5.3</span>
+ <span class="aui-icon aui-icon-small
atb-icon-arrow-right">Next</span>
+ </a>
+
+ </div>
+</div><p>This is the consolidated list of changes between Tapestry versions
5.1 and 5.2. To upgrade from 5.1 to 5.2, most users will be able to just update
the Maven dependency in their POM file (or <a shape="rect"
href="download.html">download</a> the new JAR file) and the new version will
just work. However, please read carefully below before upgrading, and also
review the <a shape="rect" href="how-to-upgrade.html">How to Upgrade</a>
instructions.</p><p><strong>Contents</strong></p><p><style
type="text/css">/*<![CDATA[*/
+div.rbtoc1447003233865 {padding: 0px;}
+div.rbtoc1447003233865 ul {list-style: disc;margin-left: 0px;}
+div.rbtoc1447003233865 li {margin-left: 0px;padding-left: 0px;}
-/*]]>*/</style></p><div class="toc-macro rbtoc1437340824369">
+/*]]>*/</style></p><div class="toc-macro rbtoc1447003233865">
<ul class="toc-indentation"><li><a shape="rect"
href="#ReleaseNotes5.2-BreakingChanges">Breaking Changes</a></li><li><a
shape="rect" href="#ReleaseNotes5.2-ReleaseNotes:Tapestry5.2.6">Release Notes:
Tapestry 5.2.6</a></li><li><a shape="rect"
href="#ReleaseNotes5.2-ReleaseNotes:Tapestry5.2.5">Release Notes: Tapestry
5.2.5</a></li><li><a shape="rect"
href="#ReleaseNotes5.2-ReleaseNotes:Tapestry5.2.4">Release Notes: Tapestry
5.2.4</a></li><li><a shape="rect"
href="#ReleaseNotes5.2-ReleaseNotes:Tapestry5.2.3">Release Notes: Tapestry
5.2.3</a></li><li><a shape="rect"
href="#ReleaseNotes5.2-ReleaseNotes:Tapestry5.2.2">Release Notes: Tapestry
5.2.2</a></li><li><a shape="rect"
href="#ReleaseNotes5.2-ReleaseNotes:Tapestry5.2.1">Release Notes: Tapestry
5.2.1</a></li><li><a shape="rect"
href="#ReleaseNotes5.2-ReleaseNotes:Tapestry5.2.0">Release Notes: Tapestry
5.2.0</a></li></ul>
</div><h2 id="ReleaseNotes5.2-BreakingChanges">Breaking Changes</h2><p>The
following changes have been made in Tapestry 5.2 that are likely to result in
unexpected behavior if your application relies on the changed functionality.
Please review this list carefully before upgrading from 5.1 to 5.2. Also check
the <a shape="rect" class="external-link"
href="http://tapestry.apache.org/current/apidocs/deprecated-list.html";>Deprecated
API List</a> for non-breaking changes.</p><ul><li>Page classes with instance
variables that are not thread safe must be created in a method rather than
declared as an instance variable. For example, creating an instance variable
<code>private final DateFormat format =
DateFormat.getDateInstance(DateFormat.MEDIUM, locale);</code> in a page and
using it will cause problems because DateFormat is not thread safe. Instead,
you must create the DateFormat in a method. See <a shape="rect"
href="release-notes-52.html">Release Notes: Tapestry 5.2.0</a> (below) for det
ails.</li><li><a shape="rect" class="external-link"
href="http://tapestry.apache.org/current/apidocs/org/apache/tapestry5/Link.html#toAbsoluteURI%28%29";>Link.toAbsoluteURI()</a>
now returns the absolute URL, which includes the scheme, hostname and possibly
port (e.g., "http://example.com:8080/myapp/viewproduct/4";), rather than a
relative URL (e.g., "/myapp/viewproduct/4"). See <a shape="rect"
href="release-notes-52.html">Release Notes: Tapestry 5.2.2</a> (below) for
details.</li><li>The <a shape="rect" class="external-link"
href="http://tapestry.apache.org/tapestry5.2-dev/tapestry-core/ref/org/apache/tapestry5/corelib/components/Label.html";>Label</a>
component no longer outputs an id:</li></ul><p>Previously valid code in
5.1.0.5:</p><div class="code panel pdl" style="border-width: 1px;"><div
class="codeContent panelContent pdl">
<pre class="brush: xml; gutter: false; theme: Default"
style="font-size:12px;"><t:form><t:label
for="search"/><t:textfield t:id="search"
size="50"/></t:form></pre>
@@ -263,7 +286,30 @@ built-in translators. This will break ex
<h3 id="ReleaseNotes5.2-TasksCompleted.2">Tasks Completed</h3>
<ul><li><a shape="rect" class="external-link"
href="https://issues.apache.org/jira/browse/TAP5-11";>TAP5-11</a> –
CookiesImplTest does specify a domain cookie with a domain not prefixed with a
. (dot)</li><li><a shape="rect" class="external-link"
href="https://issues.apache.org/jira/browse/TAP5-556";>TAP5-556</a> – Fix
TranslatorSourceImplTest</li><li><a shape="rect" class="external-link"
href="https://issues.apache.org/jira/browse/TAP5-756";>TAP5-756</a> – Add
ioko-tapestry-commons to the related projects list</li><li><a shape="rect"
class="external-link"
href="https://issues.apache.org/jira/browse/TAP5-819";>TAP5-819</a> –
remove ide-specific files from all sub-modules and add them to
svn:ignore</li><li><a shape="rect" class="external-link"
href="https://issues.apache.org/jira/browse/TAP5-969";>TAP5-969</a> –
Method AbstractField.createDefaultParameterBinding() should be
deprecated</li><li><a shape="rect" class="external-link"
href="https://issues.apache.o
rg/jira/browse/TAP5-976">TAP5-976</a> – Upgrade Spring dependencies to
version 3.0.0.RELEASE</li><li><a shape="rect" class="external-link"
href="https://issues.apache.org/jira/browse/TAP5-1081";>TAP5-1081</a> –
Remove formos references from 5.2.0 archetype</li><li><a shape="rect"
class="external-link"
href="https://issues.apache.org/jira/browse/TAP5-1087";>TAP5-1087</a> –
Upgrade TestNG dependencies to version 5.12.1</li><li><a shape="rect"
class="external-link"
href="https://issues.apache.org/jira/browse/TAP5-1134";>TAP5-1134</a> –
Upgrade Hibernate dependencies to 3.5.2</li><li><a shape="rect"
class="external-link"
href="https://issues.apache.org/jira/browse/TAP5-1195";>TAP5-1195</a> –
Rename annotations @QueryParameter and @QueryParameterMapped (both introduced
in 5.2.0) to more mnemonic names</li></ul>
-</div>
+
+<div class="atb-scrollbar-macro">
+ <div class="prev">
+ <a shape="rect" href="release-notes-51.html" rel="prev">
+ <span class="aui-icon aui-icon-small
atb-icon-arrow-left">Previous</span>
+ <span class="title">Release Notes 5.1</span>
+ </a>
+
+ </div>
+ <div class="parent">
+ <a shape="rect" href="release-notes.html" rel="parent">
+ <span class="aui-icon
aui-icon-small atb-icon-arrow-up">Up</span>
+ <span class="title">Release
Notes</span>
+ </a>
+
+ </div>
+ <div class="next">
+ <a shape="rect" href="release-notes-53.html" rel="next">
+ <span class="title">Release Notes 5.3</span>
+ <span class="aui-icon aui-icon-small
atb-icon-arrow-right">Next</span>
+ </a>
+
+ </div>
+</div></div>
</div>
<div class="clearer"></div>
Modified: websites/production/tapestry/content/release-notes-53.html
==============================================================================
--- websites/production/tapestry/content/release-notes-53.html (original)
+++ websites/production/tapestry/content/release-notes-53.html Sun Nov 8
17:21:51 2015
@@ -67,17 +67,40 @@
</div>
<div id="content">
-<div id="ConfluenceContent">
+<div id="ConfluenceContent">
+<div class="atb-scrollbar-macro">
+ <div class="prev">
+ <a shape="rect" href="release-notes-52.html" rel="prev">
+ <span class="aui-icon aui-icon-small
atb-icon-arrow-left">Previous</span>
+ <span class="title">Release Notes 5.2</span>
+ </a>
+
+ </div>
+ <div class="parent">
+ <a shape="rect" href="release-notes.html" rel="parent">
+ <span class="aui-icon
aui-icon-small atb-icon-arrow-up">Up</span>
+ <span class="title">Release
Notes</span>
+ </a>
+
+ </div>
+ <div class="next">
+ <a shape="rect" href="release-notes-531.html" rel="next">
+ <span class="title">Release Notes 5.3.1</span>
+ <span class="aui-icon aui-icon-small
atb-icon-arrow-right">Next</span>
+ </a>
+
+ </div>
+</div>
<p>This is the consolidated list of changes between Tapestry versions 5.2 and
5.3. To upgrade from 5.2 to 5.3, most users who are not using deprecated
features will be able to just update the Maven dependency in their POM file (or
<a shape="rect" href="download.html">download</a> the new JAR file) and the new
version will just work. However, please read carefully below before upgrading,
and also review the <a shape="rect" href="how-to-upgrade.html">How to
Upgrade</a> instructions.</p>
<p><strong>Contents</strong></p>
<style type="text/css">/*<![CDATA[*/
-div.rbtoc1437340812101 {padding: 0px;}
-div.rbtoc1437340812101 ul {list-style: disc;margin-left: 0px;}
-div.rbtoc1437340812101 li {margin-left: 0px;padding-left: 0px;}
+div.rbtoc1447003219213 {padding: 0px;}
+div.rbtoc1447003219213 ul {list-style: disc;margin-left: 0px;}
+div.rbtoc1447003219213 li {margin-left: 0px;padding-left: 0px;}
-/*]]>*/</style><div class="toc-macro rbtoc1437340812101">
+/*]]>*/</style><div class="toc-macro rbtoc1447003219213">
<ul class="toc-indentation"><li><a shape="rect"
href="#ReleaseNotes5.3-BreakingChanges">Breaking Changes</a></li><li><a
shape="rect" href="#ReleaseNotes5.3-NewFeatures">New Features</a></li><li><a
shape="rect" href="#ReleaseNotes5.3-Sub-tasksCompleted">Sub-tasks
Completed</a></li><li><a shape="rect" href="#ReleaseNotes5.3-BugsFixed">Bugs
Fixed</a></li><li><a shape="rect"
href="#ReleaseNotes5.3-ImprovementsMade">Improvements Made</a></li><li><a
shape="rect" href="#ReleaseNotes5.3-NewFeaturesImplemented">New Features
Implemented</a></li><li><a shape="rect"
href="#ReleaseNotes5.3-TasksCompleted">Tasks Completed</a></li></ul>
</div>
@@ -501,7 +524,31 @@ div.rbtoc1437340812101 li {margin-left:
<p></p>
<p></p><p></p><p></p>
-</div>
+
+
+<div class="atb-scrollbar-macro">
+ <div class="prev">
+ <a shape="rect" href="release-notes-52.html" rel="prev">
+ <span class="aui-icon aui-icon-small
atb-icon-arrow-left">Previous</span>
+ <span class="title">Release Notes 5.2</span>
+ </a>
+
+ </div>
+ <div class="parent">
+ <a shape="rect" href="release-notes.html" rel="parent">
+ <span class="aui-icon
aui-icon-small atb-icon-arrow-up">Up</span>
+ <span class="title">Release
Notes</span>
+ </a>
+
+ </div>
+ <div class="next">
+ <a shape="rect" href="release-notes-531.html" rel="next">
+ <span class="title">Release Notes 5.3.1</span>
+ <span class="aui-icon aui-icon-small
atb-icon-arrow-right">Next</span>
+ </a>
+
+ </div>
+</div></div>
</div>
<div class="clearer"></div>
Modified: websites/production/tapestry/content/release-notes-531.html
==============================================================================
--- websites/production/tapestry/content/release-notes-531.html (original)
+++ websites/production/tapestry/content/release-notes-531.html Sun Nov 8
17:21:51 2015
@@ -67,7 +67,30 @@
</div>
<div id="content">
-<div id="ConfluenceContent">
+<div id="ConfluenceContent">
+<div class="atb-scrollbar-macro">
+ <div class="prev">
+ <a shape="rect" href="release-notes-53.html" rel="prev">
+ <span class="aui-icon aui-icon-small
atb-icon-arrow-left">Previous</span>
+ <span class="title">Release Notes 5.3</span>
+ </a>
+
+ </div>
+ <div class="parent">
+ <a shape="rect" href="release-notes.html" rel="parent">
+ <span class="aui-icon
aui-icon-small atb-icon-arrow-up">Up</span>
+ <span class="title">Release
Notes</span>
+ </a>
+
+ </div>
+ <div class="next">
+ <a shape="rect" href="release-notes-532.html" rel="next">
+ <span class="title">Release Notes 5.3.2</span>
+ <span class="aui-icon aui-icon-small
atb-icon-arrow-right">Next</span>
+ </a>
+
+ </div>
+</div>
<p>This bugfix release is a drop-in replacement for the <a shape="rect"
href="release-notes-53.html">5.3</a> release. Any 5.3 user is encouraged to
upgrade. Be sure to review the <a shape="rect" href="how-to-upgrade.html">How
to Upgrade</a> instructions first, though.</p>
@@ -93,7 +116,31 @@
<p></p>
-</div>
+
+
+<div class="atb-scrollbar-macro">
+ <div class="prev">
+ <a shape="rect" href="release-notes-53.html" rel="prev">
+ <span class="aui-icon aui-icon-small
atb-icon-arrow-left">Previous</span>
+ <span class="title">Release Notes 5.3</span>
+ </a>
+
+ </div>
+ <div class="parent">
+ <a shape="rect" href="release-notes.html" rel="parent">
+ <span class="aui-icon
aui-icon-small atb-icon-arrow-up">Up</span>
+ <span class="title">Release
Notes</span>
+ </a>
+
+ </div>
+ <div class="next">
+ <a shape="rect" href="release-notes-532.html" rel="next">
+ <span class="title">Release Notes 5.3.2</span>
+ <span class="aui-icon aui-icon-small
atb-icon-arrow-right">Next</span>
+ </a>
+
+ </div>
+</div></div>
</div>
<div class="clearer"></div>
Modified: websites/production/tapestry/content/release-notes-532.html
==============================================================================
--- websites/production/tapestry/content/release-notes-532.html (original)
+++ websites/production/tapestry/content/release-notes-532.html Sun Nov 8
17:21:51 2015
@@ -67,7 +67,30 @@
</div>
<div id="content">
-<div id="ConfluenceContent">
+<div id="ConfluenceContent">
+<div class="atb-scrollbar-macro">
+ <div class="prev">
+ <a shape="rect" href="release-notes-531.html" rel="prev">
+ <span class="aui-icon aui-icon-small
atb-icon-arrow-left">Previous</span>
+ <span class="title">Release Notes 5.3.1</span>
+ </a>
+
+ </div>
+ <div class="parent">
+ <a shape="rect" href="release-notes.html" rel="parent">
+ <span class="aui-icon
aui-icon-small atb-icon-arrow-up">Up</span>
+ <span class="title">Release
Notes</span>
+ </a>
+
+ </div>
+ <div class="next">
+ <a shape="rect" href="release-notes-533.html" rel="next">
+ <span class="title">Release Notes 5.3.3</span>
+ <span class="aui-icon aui-icon-small
atb-icon-arrow-right">Next</span>
+ </a>
+
+ </div>
+</div>
<p>This is the consolidated list of changes between Tapestry versions 5.3.1
and 5.3.2. To upgrade, just update the Maven dependency in you POM file (or <a
shape="rect" href="download.html">download</a> the new JAR file) and the new
version will just work. However, please review the <a shape="rect"
href="how-to-upgrade.html">How to Upgrade</a> instructions before upgrading.
And be sure to check the <a shape="rect" href="release-notes-53.html">Release
Notes for 5.3</a> and <a shape="rect" href="release-notes-531.html">Release
Notes for 5.3.1</a> too.</p>
@@ -102,7 +125,31 @@
</li></ul>
<p></p>
-</div>
+
+
+<div class="atb-scrollbar-macro">
+ <div class="prev">
+ <a shape="rect" href="release-notes-531.html" rel="prev">
+ <span class="aui-icon aui-icon-small
atb-icon-arrow-left">Previous</span>
+ <span class="title">Release Notes 5.3.1</span>
+ </a>
+
+ </div>
+ <div class="parent">
+ <a shape="rect" href="release-notes.html" rel="parent">
+ <span class="aui-icon
aui-icon-small atb-icon-arrow-up">Up</span>
+ <span class="title">Release
Notes</span>
+ </a>
+
+ </div>
+ <div class="next">
+ <a shape="rect" href="release-notes-533.html" rel="next">
+ <span class="title">Release Notes 5.3.3</span>
+ <span class="aui-icon aui-icon-small
atb-icon-arrow-right">Next</span>
+ </a>
+
+ </div>
+</div></div>
</div>
<div class="clearer"></div>
Modified: websites/production/tapestry/content/release-notes-533.html
==============================================================================
--- websites/production/tapestry/content/release-notes-533.html (original)
+++ websites/production/tapestry/content/release-notes-533.html Sun Nov 8
17:21:51 2015
@@ -67,7 +67,30 @@
</div>
<div id="content">
-<div id="ConfluenceContent">
+<div id="ConfluenceContent">
+<div class="atb-scrollbar-macro">
+ <div class="prev">
+ <a shape="rect" href="release-notes-532.html" rel="prev">
+ <span class="aui-icon aui-icon-small
atb-icon-arrow-left">Previous</span>
+ <span class="title">Release Notes 5.3.2</span>
+ </a>
+
+ </div>
+ <div class="parent">
+ <a shape="rect" href="release-notes.html" rel="parent">
+ <span class="aui-icon
aui-icon-small atb-icon-arrow-up">Up</span>
+ <span class="title">Release
Notes</span>
+ </a>
+
+ </div>
+ <div class="next">
+ <a shape="rect" href="release-notes-534.html" rel="next">
+ <span class="title">Release Notes 5.3.4</span>
+ <span class="aui-icon aui-icon-small
atb-icon-arrow-right">Next</span>
+ </a>
+
+ </div>
+</div>
<p>This is the consolidated list of changes between Tapestry versions 5.3.2
and 5.3.3. Tapestry 5.3.3 is a drop-in replacement for prior Tapestry 5.3
releases. To upgrade, just update the Maven dependency in you POM file (or <a
shape="rect" href="download.html">download</a> the new JAR file) and the new
version will just work. However, please review the <a shape="rect"
href="how-to-upgrade.html">How to Upgrade</a> instructions before upgrading.
</p>
@@ -98,7 +121,31 @@
<p></p>
-</div>
+
+
+<div class="atb-scrollbar-macro">
+ <div class="prev">
+ <a shape="rect" href="release-notes-532.html" rel="prev">
+ <span class="aui-icon aui-icon-small
atb-icon-arrow-left">Previous</span>
+ <span class="title">Release Notes 5.3.2</span>
+ </a>
+
+ </div>
+ <div class="parent">
+ <a shape="rect" href="release-notes.html" rel="parent">
+ <span class="aui-icon
aui-icon-small atb-icon-arrow-up">Up</span>
+ <span class="title">Release
Notes</span>
+ </a>
+
+ </div>
+ <div class="next">
+ <a shape="rect" href="release-notes-534.html" rel="next">
+ <span class="title">Release Notes 5.3.4</span>
+ <span class="aui-icon aui-icon-small
atb-icon-arrow-right">Next</span>
+ </a>
+
+ </div>
+</div></div>
</div>
<div class="clearer"></div>
Modified: websites/production/tapestry/content/release-notes-534.html
==============================================================================
--- websites/production/tapestry/content/release-notes-534.html (original)
+++ websites/production/tapestry/content/release-notes-534.html Sun Nov 8
17:21:51 2015
@@ -67,7 +67,30 @@
</div>
<div id="content">
-<div id="ConfluenceContent">
+<div id="ConfluenceContent">
+<div class="atb-scrollbar-macro">
+ <div class="prev">
+ <a shape="rect" href="release-notes-533.html" rel="prev">
+ <span class="aui-icon aui-icon-small
atb-icon-arrow-left">Previous</span>
+ <span class="title">Release Notes 5.3.3</span>
+ </a>
+
+ </div>
+ <div class="parent">
+ <a shape="rect" href="release-notes.html" rel="parent">
+ <span class="aui-icon
aui-icon-small atb-icon-arrow-up">Up</span>
+ <span class="title">Release
Notes</span>
+ </a>
+
+ </div>
+ <div class="next">
+ <a shape="rect" href="release-notes-535.html" rel="next">
+ <span class="title">Release Notes 5.3.5</span>
+ <span class="aui-icon aui-icon-small
atb-icon-arrow-right">Next</span>
+ </a>
+
+ </div>
+</div>
<p>This is the consolidated list of changes between Tapestry versions 5.3.3
and 5.3.4. Tapestry 5.3.4 is a drop-in replacement for prior Tapestry 5.3
releases. To upgrade, just update the Maven dependency in you POM file (or <a
shape="rect" href="download.html">download</a> the new JAR file) and the new
version will just work. However, please review the <a shape="rect"
href="how-to-upgrade.html">How to Upgrade</a> instructions before upgrading.
</p>
@@ -98,7 +121,31 @@
</li></ul>
<p></p>
-</div>
+
+
+<div class="atb-scrollbar-macro">
+ <div class="prev">
+ <a shape="rect" href="release-notes-533.html" rel="prev">
+ <span class="aui-icon aui-icon-small
atb-icon-arrow-left">Previous</span>
+ <span class="title">Release Notes 5.3.3</span>
+ </a>
+
+ </div>
+ <div class="parent">
+ <a shape="rect" href="release-notes.html" rel="parent">
+ <span class="aui-icon
aui-icon-small atb-icon-arrow-up">Up</span>
+ <span class="title">Release
Notes</span>
+ </a>
+
+ </div>
+ <div class="next">
+ <a shape="rect" href="release-notes-535.html" rel="next">
+ <span class="title">Release Notes 5.3.5</span>
+ <span class="aui-icon aui-icon-small
atb-icon-arrow-right">Next</span>
+ </a>
+
+ </div>
+</div></div>
</div>
<div class="clearer"></div>
Modified: websites/production/tapestry/content/release-notes-535.html
==============================================================================
--- websites/production/tapestry/content/release-notes-535.html (original)
+++ websites/production/tapestry/content/release-notes-535.html Sun Nov 8
17:21:51 2015
@@ -67,7 +67,30 @@
</div>
<div id="content">
-<div id="ConfluenceContent">
+<div id="ConfluenceContent">
+<div class="atb-scrollbar-macro">
+ <div class="prev">
+ <a shape="rect" href="release-notes-534.html" rel="prev">
+ <span class="aui-icon aui-icon-small
atb-icon-arrow-left">Previous</span>
+ <span class="title">Release Notes 5.3.4</span>
+ </a>
+
+ </div>
+ <div class="parent">
+ <a shape="rect" href="release-notes.html" rel="parent">
+ <span class="aui-icon
aui-icon-small atb-icon-arrow-up">Up</span>
+ <span class="title">Release
Notes</span>
+ </a>
+
+ </div>
+ <div class="next">
+ <a shape="rect" href="release-notes-536.html" rel="next">
+ <span class="title">Release Notes 5.3.6</span>
+ <span class="aui-icon aui-icon-small
atb-icon-arrow-right">Next</span>
+ </a>
+
+ </div>
+</div>
<p></p><p></p><p></p><p></p><p></p><p></p><p></p><p></p><p></p><p></p><p></p>
<p>This is the consolidated list of changes between Tapestry included in
version 5.3.5. Tapestry 5.3.5 is a drop-in replacement for prior Tapestry 5.3
releases. To upgrade, just update the Maven dependency in you POM file (or <a
shape="rect" href="download.html">download</a> the new JAR file) and the new
version will just work. However, please review the <a shape="rect"
href="how-to-upgrade.html">How to Upgrade</a> instructions before upgrading.
</p>
@@ -100,7 +123,31 @@
<ul><li>[<a shape="rect"
href="https://issues.apache.org/jira/browse/TAP5-1989";>TAP5-1989</a>] -
Upgrade bundled Prototype to version 1.7.1
</li></ul>
- <p></p></div>
+ <p></p>
+
+<div class="atb-scrollbar-macro">
+ <div class="prev">
+ <a shape="rect" href="release-notes-534.html" rel="prev">
+ <span class="aui-icon aui-icon-small
atb-icon-arrow-left">Previous</span>
+ <span class="title">Release Notes 5.3.4</span>
+ </a>
+
+ </div>
+ <div class="parent">
+ <a shape="rect" href="release-notes.html" rel="parent">
+ <span class="aui-icon
aui-icon-small atb-icon-arrow-up">Up</span>
+ <span class="title">Release
Notes</span>
+ </a>
+
+ </div>
+ <div class="next">
+ <a shape="rect" href="release-notes-536.html" rel="next">
+ <span class="title">Release Notes 5.3.6</span>
+ <span class="aui-icon aui-icon-small
atb-icon-arrow-right">Next</span>
+ </a>
+
+ </div>
+</div></div>
</div>
<div class="clearer"></div>
Modified: websites/production/tapestry/content/release-notes-536.html
==============================================================================
--- websites/production/tapestry/content/release-notes-536.html (original)
+++ websites/production/tapestry/content/release-notes-536.html Sun Nov 8
17:21:51 2015
@@ -67,7 +67,30 @@
</div>
<div id="content">
-<div id="ConfluenceContent">
+<div id="ConfluenceContent">
+<div class="atb-scrollbar-macro">
+ <div class="prev">
+ <a shape="rect" href="release-notes-535.html" rel="prev">
+ <span class="aui-icon aui-icon-small
atb-icon-arrow-left">Previous</span>
+ <span class="title">Release Notes 5.3.5</span>
+ </a>
+
+ </div>
+ <div class="parent">
+ <a shape="rect" href="release-notes.html" rel="parent">
+ <span class="aui-icon
aui-icon-small atb-icon-arrow-up">Up</span>
+ <span class="title">Release
Notes</span>
+ </a>
+
+ </div>
+ <div class="next">
+ <a shape="rect" href="release-notes-537.html" rel="next">
+ <span class="title">Release Notes 5.3.7</span>
+ <span class="aui-icon aui-icon-small
atb-icon-arrow-right">Next</span>
+ </a>
+
+ </div>
+</div>
<p>This is the consolidated list of changes between Tapestry versions 5.3.5
and 5.3.6. Tapestry 5.3.6 is a drop-in replacement for prior Tapestry 5.3
releases. To upgrade, just update the Maven dependency in your POM file (or <a
shape="rect" href="download.html">download</a> the new JAR file) and the new
version will just work. However, please review the <a shape="rect"
href="how-to-upgrade.html">How to Upgrade</a> instructions before upgrading.
</p>
@@ -96,7 +119,31 @@
<ul><li>[<a shape="rect"
href="https://issues.apache.org/jira/browse/TAP5-1996";>TAP5-1996</a>] -
Add Severity.SUCCESS enum for alerts
</li></ul>
- <p></p></div>
+ <p></p>
+
+<div class="atb-scrollbar-macro">
+ <div class="prev">
+ <a shape="rect" href="release-notes-535.html" rel="prev">
+ <span class="aui-icon aui-icon-small
atb-icon-arrow-left">Previous</span>
+ <span class="title">Release Notes 5.3.5</span>
+ </a>
+
+ </div>
+ <div class="parent">
+ <a shape="rect" href="release-notes.html" rel="parent">
+ <span class="aui-icon
aui-icon-small atb-icon-arrow-up">Up</span>
+ <span class="title">Release
Notes</span>
+ </a>
+
+ </div>
+ <div class="next">
+ <a shape="rect" href="release-notes-537.html" rel="next">
+ <span class="title">Release Notes 5.3.7</span>
+ <span class="aui-icon aui-icon-small
atb-icon-arrow-right">Next</span>
+ </a>
+
+ </div>
+</div></div>
</div>
<div class="clearer"></div>
Modified: websites/production/tapestry/content/release-notes-537.html
==============================================================================
--- websites/production/tapestry/content/release-notes-537.html (original)
+++ websites/production/tapestry/content/release-notes-537.html Sun Nov 8
17:21:51 2015
@@ -67,7 +67,30 @@
</div>
<div id="content">
-<div id="ConfluenceContent">
+<div id="ConfluenceContent">
+<div class="atb-scrollbar-macro">
+ <div class="prev">
+ <a shape="rect" href="release-notes-536.html" rel="prev">
+ <span class="aui-icon aui-icon-small
atb-icon-arrow-left">Previous</span>
+ <span class="title">Release Notes 5.3.6</span>
+ </a>
+
+ </div>
+ <div class="parent">
+ <a shape="rect" href="release-notes.html" rel="parent">
+ <span class="aui-icon
aui-icon-small atb-icon-arrow-up">Up</span>
+ <span class="title">Release
Notes</span>
+ </a>
+
+ </div>
+ <div class="next">
+ <a shape="rect" href="release-notes-54.html" rel="next">
+ <span class="title">Release Notes 5.4</span>
+ <span class="aui-icon aui-icon-small
atb-icon-arrow-right">Next</span>
+ </a>
+
+ </div>
+</div>
<p>This is the consolidated list of changes between Tapestry versions 5.3.6
and 5.3.7. Tapestry 5.3.7 is a drop-in replacement for prior Tapestry 5.3
releases. To upgrade, just update the Maven dependency in your POM file (or <a
shape="rect" href="download.html">download</a> the new JAR file) and the new
version will just work. However, please review the <a shape="rect"
href="how-to-upgrade.html">How to Upgrade</a> instructions before upgrading.</p>
@@ -109,7 +132,31 @@
<ul><li>[<a shape="rect"
href="https://issues.apache.org/jira/browse/TAP5-2055";>TAP5-2055</a>] -
Polish translations
</li></ul>
-<p></p></div>
+<p></p>
+
+<div class="atb-scrollbar-macro">
+ <div class="prev">
+ <a shape="rect" href="release-notes-536.html" rel="prev">
+ <span class="aui-icon aui-icon-small
atb-icon-arrow-left">Previous</span>
+ <span class="title">Release Notes 5.3.6</span>
+ </a>
+
+ </div>
+ <div class="parent">
+ <a shape="rect" href="release-notes.html" rel="parent">
+ <span class="aui-icon
aui-icon-small atb-icon-arrow-up">Up</span>
+ <span class="title">Release
Notes</span>
+ </a>
+
+ </div>
+ <div class="next">
+ <a shape="rect" href="release-notes-54.html" rel="next">
+ <span class="title">Release Notes 5.4</span>
+ <span class="aui-icon aui-icon-small
atb-icon-arrow-right">Next</span>
+ </a>
+
+ </div>
+</div></div>
</div>
<div class="clearer"></div>
Modified: websites/production/tapestry/content/release-notes-54.html
==============================================================================
--- websites/production/tapestry/content/release-notes-54.html (original)
+++ websites/production/tapestry/content/release-notes-54.html Sun Nov 8
17:21:51 2015
@@ -67,7 +67,30 @@
</div>
<div id="content">
-<div id="ConfluenceContent">
+<div id="ConfluenceContent">
+<div class="atb-scrollbar-macro">
+ <div class="prev">
+ <a shape="rect" href="release-notes-537.html" rel="prev">
+ <span class="aui-icon aui-icon-small
atb-icon-arrow-left">Previous</span>
+ <span class="title">Release Notes 5.3.7</span>
+ </a>
+
+ </div>
+ <div class="parent">
+ <a shape="rect" href="release-notes.html" rel="parent">
+ <span class="aui-icon
aui-icon-small atb-icon-arrow-up">Up</span>
+ <span class="title">Release
Notes</span>
+ </a>
+
+ </div>
+ <div class="next">
+ <a shape="rect" href="release-notes-538.html" rel="next">
+ <span class="title">Release notes 5.3.8</span>
+ <span class="aui-icon aui-icon-small
atb-icon-arrow-right">Next</span>
+ </a>
+
+ </div>
+</div>
<p>This is the consolidated list of changes between Tapestry versions 5.3 and
5.4. To upgrade to 5.4, most users who are not using deprecated features will
be able to just update the dependency version in their Maven POM file or Gradle
build script (or <a shape="rect" href="download.html">download</a> the new JAR
files) and the new version will just work. However, please read carefully below
before upgrading, and also review the <a shape="rect"
href="how-to-upgrade.html">How to Upgrade</a> instructions.</p>
@@ -108,7 +131,31 @@
<p>Prior releases of Tapestry primarily organized client-side logic in terms
of JavaScript libraries. These libraries can be declaratively imported into the
page (either during a full-page render, or during an Ajax partial page update).
In addition, libraries can be combined together into <em>stacks</em>, which (in
a production application) are combined into a single virtual asset.</p>
<p>The library approach is <a shape="rect"
href="javascript-rewrite-in-54.html">fundamentally limited in a number of
ways</a>, including namespace pollution and dealing with dependencies between
libraries. Tapestry 5.4 introduces a parallel mechanism, based on <a
shape="rect" class="external-link" href="http://requirejs.org"; >RequireJS</a>
and the <a shape="rect" class="external-link"
href="https://github.com/amdjs/amdjs-api/wiki/AMD"; >Asynchronous Module
Definition</a> as a way to speed up initial page load and organize client-side
JavaScript in a more expressive and maintainable way.</p>
-</div>
+
+
+<div class="atb-scrollbar-macro">
+ <div class="prev">
+ <a shape="rect" href="release-notes-537.html" rel="prev">
+ <span class="aui-icon aui-icon-small
atb-icon-arrow-left">Previous</span>
+ <span class="title">Release Notes 5.3.7</span>
+ </a>
+
+ </div>
+ <div class="parent">
+ <a shape="rect" href="release-notes.html" rel="parent">
+ <span class="aui-icon
aui-icon-small atb-icon-arrow-up">Up</span>
+ <span class="title">Release
Notes</span>
+ </a>
+
+ </div>
+ <div class="next">
+ <a shape="rect" href="release-notes-538.html" rel="next">
+ <span class="title">Release notes 5.3.8</span>
+ <span class="aui-icon aui-icon-small
atb-icon-arrow-right">Next</span>
+ </a>
+
+ </div>
+</div></div>
</div>
<div class="clearer"></div>
Modified: websites/production/tapestry/content/release-upgrade-faq.html
==============================================================================
--- websites/production/tapestry/content/release-upgrade-faq.html (original)
+++ websites/production/tapestry/content/release-upgrade-faq.html Sun Nov 8
17:21:51 2015
@@ -67,7 +67,26 @@
</div>
<div id="content">
-<div id="ConfluenceContent">
+<div id="ConfluenceContent">
+<div class="atb-scrollbar-macro">
+ <div class="prev">
+ <a shape="rect" href="maven-support-faq.html" rel="prev">
+ <span class="aui-icon aui-icon-small
atb-icon-arrow-left">Previous</span>
+ <span class="title">Maven Support FAQ</span>
+ </a>
+
+ </div>
+ <div class="parent">
+ <a shape="rect" href="frequently-asked-questions.html"
rel="parent">
+ <span class="aui-icon
aui-icon-small atb-icon-arrow-up">Up</span>
+ <span class="title">Frequently Asked
Questions</span>
+ </a>
+
+ </div>
+ <div class="next">
+
+ </div>
+</div>
<h2 id="ReleaseUpgradeFAQ-ReleaseUpgradeFAQ">Release Upgrade FAQ </h2>
@@ -76,7 +95,27 @@
<h3
id="ReleaseUpgradeFAQ-WhydoIgetanexceptionaboutorg.apache.tapestry5.internal.services.RequestPathOptimizerafterupgradingto5.2?">Why
do I get an exception about
org.apache.tapestry5.internal.services.RequestPathOptimizer after upgrading to
5.2?</h3>
<p>Although Tapestry works very hard to keep backwards compatibility between
releases for <em>public</em> APIs, all <em>internal</em> APIs are subject to
change. This error is commonly due to the use of the ChenilleKit library, which
makes use of some internal APIs. You must also upgrade your ChenilleKit
dependency when moving from Tapestry 5.1 to 5.2 or later. See the <a
shape="rect" class="external-link"
href="http://tapestry.markmail.org/thread/3cj2wuvl4idnpmjr"; >complete
discussion of this from the Tapestry user mailing list</a>. </p>
-</div>
+
+
+<div class="atb-scrollbar-macro">
+ <div class="prev">
+ <a shape="rect" href="maven-support-faq.html" rel="prev">
+ <span class="aui-icon aui-icon-small
atb-icon-arrow-left">Previous</span>
+ <span class="title">Maven Support FAQ</span>
+ </a>
+
+ </div>
+ <div class="parent">
+ <a shape="rect" href="frequently-asked-questions.html"
rel="parent">
+ <span class="aui-icon
aui-icon-small atb-icon-arrow-up">Up</span>
+ <span class="title">Frequently Asked
Questions</span>
+ </a>
+
+ </div>
+ <div class="next">
+
+ </div>
+</div></div>
</div>
<div class="clearer"></div>
Modified: websites/production/tapestry/content/request-processing-faq.html
==============================================================================
--- websites/production/tapestry/content/request-processing-faq.html (original)
+++ websites/production/tapestry/content/request-processing-faq.html Sun Nov 8
17:21:51 2015
@@ -67,7 +67,30 @@
</div>
<div id="content">
-<div id="ConfluenceContent">
+<div id="ConfluenceContent">
+<div class="atb-scrollbar-macro">
+ <div class="prev">
+ <a shape="rect" href="integration-with-existing-applications.html"
rel="prev">
+ <span class="aui-icon aui-icon-small
atb-icon-arrow-left">Previous</span>
+ <span class="title">Integration with existing
applications</span>
+ </a>
+
+ </div>
+ <div class="parent">
+ <a shape="rect" href="frequently-asked-questions.html"
rel="parent">
+ <span class="aui-icon
aui-icon-small atb-icon-arrow-up">Up</span>
+ <span class="title">Frequently Asked
Questions</span>
+ </a>
+
+ </div>
+ <div class="next">
+ <a shape="rect" href="limitations.html" rel="next">
+ <span class="title">Limitations</span>
+ <span class="aui-icon aui-icon-small
atb-icon-arrow-right">Next</span>
+ </a>
+
+ </div>
+</div>
<h2 id="RequestProcessingFAQ-RequestProcessing">Request Processing</h2>
@@ -90,7 +113,30 @@ public static void contributeIgnoredPath
<p>Alternately, you can configure the Tapestry application to execute inside a
folder to avoid conflicts. See the notes on the <a shape="rect"
href="configuration.html">configuration page</a>.</p>
- </div>
+
+<div class="atb-scrollbar-macro">
+ <div class="prev">
+ <a shape="rect" href="integration-with-existing-applications.html"
rel="prev">
+ <span class="aui-icon aui-icon-small
atb-icon-arrow-left">Previous</span>
+ <span class="title">Integration with existing
applications</span>
+ </a>
+
+ </div>
+ <div class="parent">
+ <a shape="rect" href="frequently-asked-questions.html"
rel="parent">
+ <span class="aui-icon
aui-icon-small atb-icon-arrow-up">Up</span>
+ <span class="title">Frequently Asked
Questions</span>
+ </a>
+
+ </div>
+ <div class="next">
+ <a shape="rect" href="limitations.html" rel="next">
+ <span class="title">Limitations</span>
+ <span class="aui-icon aui-icon-small
atb-icon-arrow-right">Next</span>
+ </a>
+
+ </div>
+</div> </div>
</div>
<div class="clearer"></div>
Modified: websites/production/tapestry/content/security-faq.html
==============================================================================
--- websites/production/tapestry/content/security-faq.html (original)
+++ websites/production/tapestry/content/security-faq.html Sun Nov 8 17:21:51
2015
@@ -67,7 +67,30 @@
</div>
<div id="content">
-<div id="ConfluenceContent"><h2 id="SecurityFAQ-SecurityFAQ">Security
FAQ</h2><p> </p><div class="aui-label" style="float:right" title="Related
Articles">
+<div id="ConfluenceContent"><p>
+</p><div class="atb-scrollbar-macro">
+ <div class="prev">
+ <a shape="rect" href="tapestry-inversion-of-control-faq.html"
rel="prev">
+ <span class="aui-icon aui-icon-small
atb-icon-arrow-left">Previous</span>
+ <span class="title">Tapestry Inversion of
Control FAQ</span>
+ </a>
+
+ </div>
+ <div class="parent">
+ <a shape="rect" href="frequently-asked-questions.html"
rel="parent">
+ <span class="aui-icon
aui-icon-small atb-icon-arrow-up">Up</span>
+ <span class="title">Frequently Asked
Questions</span>
+ </a>
+
+ </div>
+ <div class="next">
+ <a shape="rect" href="integration-with-existing-applications.html"
rel="next">
+ <span class="title">Integration with existing
applications</span>
+ <span class="aui-icon aui-icon-small
atb-icon-arrow-right">Next</span>
+ </a>
+
+ </div>
+</div><h2 id="SecurityFAQ-SecurityFAQ">Security FAQ</h2><p> </p><div
class="aui-label" style="float:right" title="Related Articles">
@@ -113,7 +136,30 @@
if (productionMode) { configuration.override("LocalhostOnly", null); }
}
</pre>
-</div></div><p></p></div>
+</div></div><p>
+</p><div class="atb-scrollbar-macro">
+ <div class="prev">
+ <a shape="rect" href="tapestry-inversion-of-control-faq.html"
rel="prev">
+ <span class="aui-icon aui-icon-small
atb-icon-arrow-left">Previous</span>
+ <span class="title">Tapestry Inversion of
Control FAQ</span>
+ </a>
+
+ </div>
+ <div class="parent">
+ <a shape="rect" href="frequently-asked-questions.html"
rel="parent">
+ <span class="aui-icon
aui-icon-small atb-icon-arrow-up">Up</span>
+ <span class="title">Frequently Asked
Questions</span>
+ </a>
+
+ </div>
+ <div class="next">
+ <a shape="rect" href="integration-with-existing-applications.html"
rel="next">
+ <span class="title">Integration with existing
applications</span>
+ <span class="aui-icon aui-icon-small
atb-icon-arrow-right">Next</span>
+ </a>
+
+ </div>
+</div></div>
</div>
<div class="clearer"></div>
Modified: websites/production/tapestry/content/session-storage.html
==============================================================================
--- websites/production/tapestry/content/session-storage.html (original)
+++ websites/production/tapestry/content/session-storage.html Sun Nov 8
17:21:51 2015
@@ -109,11 +109,11 @@
</div><p>Ordinary <a shape="rect"
href="persistent-page-data.html">page-persistent fields</a> won't work for
this, since persistent fields are available only to a specific page, not shared
across multiple pages.</p><p>Tapestry provides two mechanisms for storing such
data: Session State Objects and Session Attributes. When deciding between the
two, it's best to use Session State Objects for complex objects, and Session
Attributes for simple types.</p><h2
id="SessionStorage-SessionStateObjects">Session State Objects</h2><p>With a
Session State Object (SSO), the value is automatically stored outside the page;
with the default storage strategy, it is stored in the session. Such a value is
global to all pages <em>for the same user</em>, but is stored separately for
different users.</p><p>A field holding an SSO is marked with the @<a
shape="rect" class="external-link"
href="http://tapestry.apache.org/current/apidocs/org/apache/tapestry5/annotations/SessionState.html";>SessionState</a>
ann
otation.</p><div class="navmenu" style="float:right; background:white;
margin:3px; padding:3px">
<div class="panel" style="border-width: 1px;"><div class="panelHeader"
style="border-bottom-width: 1px;"><b>Contents</b></div><div
class="panelContent">
<style type="text/css">/*<![CDATA[*/
-div.rbtoc1437945582068 {padding: 0px;}
-div.rbtoc1437945582068 ul {list-style: disc;margin-left: 0px;}
-div.rbtoc1437945582068 li {margin-left: 0px;padding-left: 0px;}
+div.rbtoc1447003269495 {padding: 0px;}
+div.rbtoc1447003269495 ul {list-style: disc;margin-left: 0px;}
+div.rbtoc1447003269495 li {margin-left: 0px;padding-left: 0px;}
-/*]]>*/</style><div class="toc-macro rbtoc1437945582068">
+/*]]>*/</style><div class="toc-macro rbtoc1447003269495">
<ul class="toc-indentation"><li>Related Articles</li></ul>
<ul><li><a shape="rect" href="#SessionStorage-SessionStateObjects">Session
State Objects</a>
<ul class="toc-indentation"><li><a shape="rect"
href="#SessionStorage-Pitfalls">Pitfalls</a></li><li><a shape="rect"
href="#SessionStorage-CheckforCreation">Check for Creation</a></li><li><a
shape="rect" href="#SessionStorage-PersistenceStrategies">Persistence
Strategies</a></li><li><a shape="rect"
href="#SessionStorage-ConfiguringSSOs">Configuring SSOs</a></li></ul>
Modified: websites/production/tapestry/content/specific-errors-faq.html
==============================================================================
--- websites/production/tapestry/content/specific-errors-faq.html (original)
+++ websites/production/tapestry/content/specific-errors-faq.html Sun Nov 8
17:21:51 2015
@@ -67,7 +67,30 @@
</div>
<div id="content">
-<div id="ConfluenceContent"><div class="aui-label" style="float:right"
title="Related Articles">
+<div id="ConfluenceContent"><p>
+</p><div class="atb-scrollbar-macro">
+ <div class="prev">
+ <a shape="rect" href="limitations.html" rel="prev">
+ <span class="aui-icon aui-icon-small
atb-icon-arrow-left">Previous</span>
+ <span class="title">Limitations</span>
+ </a>
+
+ </div>
+ <div class="parent">
+ <a shape="rect" href="frequently-asked-questions.html"
rel="parent">
+ <span class="aui-icon
aui-icon-small atb-icon-arrow-up">Up</span>
+ <span class="title">Frequently Asked
Questions</span>
+ </a>
+
+ </div>
+ <div class="next">
+ <a shape="rect" href="hibernate-support-faq.html" rel="next">
+ <span class="title">Hibernate Support FAQ</span>
+ <span class="aui-icon aui-icon-small
atb-icon-arrow-right">Next</span>
+ </a>
+
+ </div>
+</div><div class="aui-label" style="float:right" title="Related Articles">
@@ -106,7 +129,30 @@
</div>
</li></ul>
-</div><h3
id="SpecificErrorsFAQ-WhydoIgettheexception"Noserviceimplementstheinterfaceorg.apache.tapestry5.internal.InternalComponentResources"whentryingtousetheBeanEditFormcomponent?">Why
do I get the exception "No service implements the interface
org.apache.tapestry5.internal.InternalComponentResources" when trying to use
the BeanEditForm component?</h3><p>This can occur when you choose the wrong
package for your data object, the object edited by the BeanEditForm component.
If you place it in the same package as your pages, Tapestry will treat it like
a page, and perform a number of transformation on it, including adding a new
constructor.</p><p>Only component classes should go in the Tapestry-controlled
packages (<code>pages</code>, <code>components</code>, <code>mixins</code> and
<code>base</code> under your application's root package). By convention, simple
data objects should go in a <code>data</code> package, and Hibernate entities
should go in an <code>entities</cod
e> package.</p><div class="confluence-information-macro
confluence-information-macro-note"><span class="aui-icon aui-icon-small
aui-iconfont-warning confluence-information-macro-icon"></span><div
class="confluence-information-macro-body"><p>This is likely a bit different in
5.3 than in 5.2 (because 5.3 builds a very different constructor into the
component) and needs to be tested in 5.3 to see what exact exception will
occur.</p></div></div><h3
id="SpecificErrorsFAQ-Igetanerrorabout"Pagedidnotgenerateanymarkupwhenrendered."butIhaveatemplate,whathappened?">I
get an error about "Page did not generate any markup when rendered." but I
have a template, what happened?</h3><p>The most common error here is that the
case of the page class did not match the case of the template. For example, you
might name your class ViewOrders, but name the template vieworders.tml. The
correct name for the template is ViewOrders.tml, matching the case of the Java
class name.</p><p>Worse, you may fi
nd that your application works during development (under Windows, which is
case insensitive) but does not work when deployed on a Linux or Unix server,
which may be case sensitive.</p><p>The other cause of this may be that your
template files simply are not being packaged up correctly with the rest of your
application. When in doubt, use the Java <code>jar</code> command to see
exactly whats inside your WAR file. Your page templates should either be in the
root folder of the WAR, or package with the corresponding .class file.</p><h3
id="SpecificErrorsFAQ-MyapplicationfailswiththeerrorPermGen,howdoIfixthis?">My
application fails with the error <strong>PermGen</strong>, how do I fix
this?</h3><p>PermGen refers to the part of the Java memory space devoted to
permanent objects, which are mostly loaded classes. When developing under
Tapestry, many more classes and class loaders are created than normal; this is
part of live class reloading. Because of this, you will want to increase the a
mount of memory Java devotes to this.</p><p>The solution is to add
<code>-XX:MaxPermSize=512m</code> to your command line. You may also want to
increase the regular amount of heap space with <code>-Xmx600M</code>. Of
course, you may need to adjust the amount of memory in each category to match
your actual application, but these are good starting values.</p><p>Java Virtual
Machine arguments can be specified inside an Eclipse launch
configuration:</p><p><span class="confluence-embedded-file-wrapper"><img
class="confluence-embedded-image confluence-thumbnail"
src="specific-errors-faq.data/eclipse-permgen.png"></span></p><h3
id="SpecificErrorsFAQ-WhydoIsometimesgetajava.lang.NoSuchMethodErrorexceptionafterreloadingmypage?">Why
do I sometimes get a <code>java.lang.NoSuchMethodError</code> exception after
reloading my page?</h3><p>Tapestry's live class reloading is not
perfect. <span style="line-height: 1.4285715;">It tends to use a lot of
Java ClassLoaders on top of the normal Class
Loaders used by the Java Virtual Machine and the servlet container. When you
change non-component classes and interfaces that are referenced by components
and pages, such as to add or change a method, only the component classes are
reloaded. The non-component classes are frozen as they were when they were
</span><em style="line-height: 1.4285715;">first</em><span style="line-height:
1.4285715;"> loaded.</span></p><p>Unfortunately, this is one of the areas where
you must restart your application entirely in order to force the new versions
of the non-component classes to be loaded into memory.</p><p> </p></div>
+</div><h3
id="SpecificErrorsFAQ-WhydoIgettheexception"Noserviceimplementstheinterfaceorg.apache.tapestry5.internal.InternalComponentResources"whentryingtousetheBeanEditFormcomponent?">Why
do I get the exception "No service implements the interface
org.apache.tapestry5.internal.InternalComponentResources" when trying to use
the BeanEditForm component?</h3><p>This can occur when you choose the wrong
package for your data object, the object edited by the BeanEditForm component.
If you place it in the same package as your pages, Tapestry will treat it like
a page, and perform a number of transformation on it, including adding a new
constructor.</p><p>Only component classes should go in the Tapestry-controlled
packages (<code>pages</code>, <code>components</code>, <code>mixins</code> and
<code>base</code> under your application's root package). By convention, simple
data objects should go in a <code>data</code> package, and Hibernate entities
should go in an <code>entities</cod
e> package.</p><div class="confluence-information-macro
confluence-information-macro-note"><span class="aui-icon aui-icon-small
aui-iconfont-warning confluence-information-macro-icon"></span><div
class="confluence-information-macro-body"><p>This is likely a bit different in
5.3 than in 5.2 (because 5.3 builds a very different constructor into the
component) and needs to be tested in 5.3 to see what exact exception will
occur.</p></div></div><h3
id="SpecificErrorsFAQ-Igetanerrorabout"Pagedidnotgenerateanymarkupwhenrendered."butIhaveatemplate,whathappened?">I
get an error about "Page did not generate any markup when rendered." but I
have a template, what happened?</h3><p>The most common error here is that the
case of the page class did not match the case of the template. For example, you
might name your class ViewOrders, but name the template vieworders.tml. The
correct name for the template is ViewOrders.tml, matching the case of the Java
class name.</p><p>Worse, you may fi
nd that your application works during development (under Windows, which is
case insensitive) but does not work when deployed on a Linux or Unix server,
which may be case sensitive.</p><p>The other cause of this may be that your
template files simply are not being packaged up correctly with the rest of your
application. When in doubt, use the Java <code>jar</code> command to see
exactly whats inside your WAR file. Your page templates should either be in the
root folder of the WAR, or package with the corresponding .class file.</p><h3
id="SpecificErrorsFAQ-MyapplicationfailswiththeerrorPermGen,howdoIfixthis?">My
application fails with the error <strong>PermGen</strong>, how do I fix
this?</h3><p>PermGen refers to the part of the Java memory space devoted to
permanent objects, which are mostly loaded classes. When developing under
Tapestry, many more classes and class loaders are created than normal; this is
part of live class reloading. Because of this, you will want to increase the a
mount of memory Java devotes to this.</p><p>The solution is to add
<code>-XX:MaxPermSize=512m</code> to your command line. You may also want to
increase the regular amount of heap space with <code>-Xmx600M</code>. Of
course, you may need to adjust the amount of memory in each category to match
your actual application, but these are good starting values.</p><p>Java Virtual
Machine arguments can be specified inside an Eclipse launch
configuration:</p><p><span class="confluence-embedded-file-wrapper"><img
class="confluence-embedded-image confluence-thumbnail"
src="specific-errors-faq.data/eclipse-permgen.png"></span></p><h3
id="SpecificErrorsFAQ-WhydoIsometimesgetajava.lang.NoSuchMethodErrorexceptionafterreloadingmypage?">Why
do I sometimes get a <code>java.lang.NoSuchMethodError</code> exception after
reloading my page?</h3><p>Tapestry's live class reloading is not
perfect. <span style="line-height: 1.4285715;">It tends to use a lot of
Java ClassLoaders on top of the normal Class
Loaders used by the Java Virtual Machine and the servlet container. When you
change non-component classes and interfaces that are referenced by components
and pages, such as to add or change a method, only the component classes are
reloaded. The non-component classes are frozen as they were when they were
</span><em style="line-height: 1.4285715;">first</em><span style="line-height:
1.4285715;"> loaded.</span></p><p>Unfortunately, this is one of the areas where
you must restart your application entirely in order to force the new versions
of the non-component classes to be loaded into memory.</p><p> 
+</p><div class="atb-scrollbar-macro">
+ <div class="prev">
+ <a shape="rect" href="limitations.html" rel="prev">
+ <span class="aui-icon aui-icon-small
atb-icon-arrow-left">Previous</span>
+ <span class="title">Limitations</span>
+ </a>
+
+ </div>
+ <div class="parent">
+ <a shape="rect" href="frequently-asked-questions.html"
rel="parent">
+ <span class="aui-icon
aui-icon-small atb-icon-arrow-up">Up</span>
+ <span class="title">Frequently Asked
Questions</span>
+ </a>
+
+ </div>
+ <div class="next">
+ <a shape="rect" href="hibernate-support-faq.html" rel="next">
+ <span class="title">Hibernate Support FAQ</span>
+ <span class="aui-icon aui-icon-small
atb-icon-arrow-right">Next</span>
+ </a>
+
+ </div>
+</div></div>
</div>
<div class="clearer"></div>
Modified:
websites/production/tapestry/content/supporting-informal-parameters.html
==============================================================================
--- websites/production/tapestry/content/supporting-informal-parameters.html
(original)
+++ websites/production/tapestry/content/supporting-informal-parameters.html
Sun Nov 8 17:21:51 2015
@@ -67,7 +67,30 @@
</div>
<div id="content">
-<div id="ConfluenceContent"><p><strong>Informal parameters</strong> are any
additional parameters beyond the parameters explicitly defined for a component
using the <a shape="rect" class="external-link"
href="http://tapestry.apache.org/tapestry5/apidocs/org/apache/tapestry5/annotations/Parameter.html";>Parameter</a>
annotation.</p><div class="aui-label" style="float:right" title="Related
Articles">
+<div id="ConfluenceContent"><p>
+</p><div class="atb-scrollbar-macro">
+ <div class="prev">
+ <a shape="rect" href="error-page-recipe.html" rel="prev">
+ <span class="aui-icon aui-icon-small
atb-icon-arrow-left">Previous</span>
+ <span class="title">Error Page Recipe</span>
+ </a>
+
+ </div>
+ <div class="parent">
+ <a shape="rect" href="cookbook.html" rel="parent">
+ <span class="aui-icon
aui-icon-small atb-icon-arrow-up">Up</span>
+ <span class="title">Cookbook</span>
+ </a>
+
+ </div>
+ <div class="next">
+ <a shape="rect" href="component-libraries.html" rel="next">
+ <span class="title">Component Libraries</span>
+ <span class="aui-icon aui-icon-small
atb-icon-arrow-right">Next</span>
+ </a>
+
+ </div>
+</div><strong>Informal parameters</strong> are any additional parameters
beyond the parameters explicitly defined for a component using the <a
shape="rect" class="external-link"
href="http://tapestry.apache.org/tapestry5/apidocs/org/apache/tapestry5/annotations/Parameter.html";>Parameter</a>
annotation.<div class="aui-label" style="float:right" title="Related Articles">
![https://cwiki.apache.org/confluence/download/attachments/23335008/Class%20Loaders.png?version=4&modificationDate=1283534469000&api=v2"](https://cwiki.apache.org/confluence/download/attachments/23335008/Class%20Loaders.png?version=4&modificationDate=1283534469000&api=v2"){kind=link}