Modified: 
websites/production/tapestry/content/page-and-component-classes-faq.html
==============================================================================
--- websites/production/tapestry/content/page-and-component-classes-faq.html 
(original)
+++ websites/production/tapestry/content/page-and-component-classes-faq.html 
Sun Nov  8 17:21:51 2015
@@ -67,7 +67,30 @@
   </div>
 
 <div id="content">
-<div id="ConfluenceContent"><h2 
id="PageAndComponentClassesFAQ-PageAndComponentClasses">Page And Component 
Classes</h2><p>Main article: <a shape="rect" 
href="component-classes.html">Component Classes</a></p><h3 
id="PageAndComponentClassesFAQ-What'sthedifferencebetweenapageandacomponent?">What's
 the difference between a page and a component?</h3><p>There's very little 
difference between the two. Pages classes must be in the 
<em>root-package</em>.<code>pages</code> package; components must be in the 
<em>root-package</em>.<code>components</code>. Pages may provide event handlers 
for certain page-specific events (such as activate and passivate). Components 
may have parameters.</p><p>Other than that, they are more equal than they are 
different. They may have templates or may render themselves in code (pages 
usually have a template, components are more likely to render only in 
code).</p><p>The major difference is that Tapestry page templates may be stored 
in the web context directory, as 
 if they were static files (they can't be accessed from the client however; a 
specific rule prevents access to files with the <code>.tml</code> 
extension).</p><div class="confluence-information-macro 
confluence-information-macro-warning"><span class="aui-icon aui-icon-small 
aui-iconfont-error confluence-information-macro-icon"></span><div 
class="confluence-information-macro-body"><p>It is possible that this feature 
may be removed in a later release. It is preferred that page templates be 
stored on the classpath, like component templates.</p></div></div><h3 
id="PageAndComponentClassesFAQ-HowdoIstoremypageclassesinadifferentpackage?">How
 do I store my page classes in a different package?</h3><p>Tapestry is very 
rigid here; you can't. Page classes must go in 
<em>root-package</em>.<code>pages</code>, component classes in 
<em>root-package</em>.<code>components</code>, etc.</p><p>You are allowed to 
create sub-packages, to help organize your code better and more logically. For 
example, you 
 might have <em>root-package</em>.<code>pages.account.ViewAccount</code>, which 
would have the page name "account/viewaccount". (<span style="line-height: 
1.4285715;">Tapestry would also create an alias "account/view", by stripping 
off the redundant "account" suffix. Either name is equally valid in your code, 
and Tapestry will use the shorter name, "account/view" in 
URLs.)</span></p><p>In addition, it is possible to define additional root 
packages for the application:</p><div class="code panel pdl" 
style="border-width: 1px;"><div class="codeContent panelContent pdl">
+<div id="ConfluenceContent">    
+<div class="atb-scrollbar-macro">
+    <div class="prev">
+        <a shape="rect" href="templating-and-markup-faq.html" rel="prev">
+                                    <span class="aui-icon aui-icon-small 
atb-icon-arrow-left">Previous</span>
+                                <span class="title">Templating and Markup 
FAQ</span>
+            </a>
+
+    </div>
+    <div class="parent">
+                    <a shape="rect" href="frequently-asked-questions.html" 
rel="parent">
+                                            <span class="aui-icon 
aui-icon-small atb-icon-arrow-up">Up</span>
+                                        <span class="title">Frequently Asked 
Questions</span>
+                </a>
+
+            </div>
+    <div class="next">
+        <a shape="rect" href="forms-and-form-components-faq.html" rel="next">
+                <span class="title">Forms and Form Components FAQ</span>
+                                    <span class="aui-icon aui-icon-small 
atb-icon-arrow-right">Next</span>
+                            </a>
+
+    </div>
+</div><h2 id="PageAndComponentClassesFAQ-PageAndComponentClasses">Page And 
Component Classes</h2><p>Main article: <a shape="rect" 
href="component-classes.html">Component Classes</a></p><h3 
id="PageAndComponentClassesFAQ-What'sthedifferencebetweenapageandacomponent?">What's
 the difference between a page and a component?</h3><p>There's very little 
difference between the two. Pages classes must be in the 
<em>root-package</em>.<code>pages</code> package; components must be in the 
<em>root-package</em>.<code>components</code>. Pages may provide event handlers 
for certain page-specific events (such as activate and passivate). Components 
may have parameters.</p><p>Other than that, they are more equal than they are 
different. They may have templates or may render themselves in code (pages 
usually have a template, components are more likely to render only in 
code).</p><p>The major difference is that Tapestry page templates may be stored 
in the web context directory, as if they were static fi
 les (they can't be accessed from the client however; a specific rule prevents 
access to files with the <code>.tml</code> extension).</p><div 
class="confluence-information-macro confluence-information-macro-warning"><span 
class="aui-icon aui-icon-small aui-iconfont-error 
confluence-information-macro-icon"></span><div 
class="confluence-information-macro-body"><p>It is possible that this feature 
may be removed in a later release. It is preferred that page templates be 
stored on the classpath, like component templates.</p></div></div><h3 
id="PageAndComponentClassesFAQ-HowdoIstoremypageclassesinadifferentpackage?">How
 do I store my page classes in a different package?</h3><p>Tapestry is very 
rigid here; you can't. Page classes must go in 
<em>root-package</em>.<code>pages</code>, component classes in 
<em>root-package</em>.<code>components</code>, etc.</p><p>You are allowed to 
create sub-packages, to help organize your code better and more logically. For 
example, you might have <em>root-pa
 ckage</em>.<code>pages.account.ViewAccount</code>, which would have the page 
name "account/viewaccount". (<span style="line-height: 1.4285715;">Tapestry 
would also create an alias "account/view", by stripping off the redundant 
"account" suffix. Either name is equally valid in your code, and Tapestry will 
use the shorter name, "account/view" in URLs.)</span></p><p>In addition, it is 
possible to define additional root packages for the application:</p><div 
class="code panel pdl" style="border-width: 1px;"><div class="codeContent 
panelContent pdl">
 <pre class="brush: java; gutter: true; theme: Default" 
style="font-size:12px;">public static void 
contributeComponentClassResolver(Configuration&lt;LibraryMapping&gt; 
configuration) {
        configuration.add(new LibraryMapping("", "com.example.app.tasks"));
        configuration.add(new LibraryMapping("", "com.example.app.chat"));
@@ -100,13 +123,13 @@ public class DBImage
 
 
 
-<span class="gliffy-container" id="gliffy-container-23527573-1598" 
data-fullwidth="750" data-ceoid="23335008" 
data-edit="${diagramEditLink.getLinkUrl()}" 
data-full="${diagramZoomLink.getLinkUrl()}" data-filename="Class Loaders">
+<span class="gliffy-container" id="gliffy-container-23527573-4485" 
data-fullwidth="750" data-ceoid="23335008" 
data-edit="${diagramEditLink.getLinkUrl()}" 
data-full="${diagramZoomLink.getLinkUrl()}" data-filename="Class Loaders">
 
-    <map id="gliffy-map-23527573-5296" name="gliffy-map-23527573-5296"></map>
+    <map id="gliffy-map-23527573-7820" name="gliffy-map-23527573-7820"></map>
 
-    <img class="gliffy-image" id="gliffy-image-23527573-1598" width="750" 
height="425" data-full-width="750" data-full-height="425" 
src="https://cwiki.apache.org/confluence/download/attachments/23335008/Class%20Loaders.png?version=4&amp;modificationDate=1283534469000&amp;api=v2";
 alt="Class Loaders" usemap="#gliffy-map-23527573-5296">
+    <img class="gliffy-image" id="gliffy-image-23527573-4485" width="750" 
height="425" data-full-width="750" data-full-height="425" 
src="https://cwiki.apache.org/confluence/download/attachments/23335008/Class%20Loaders.png?version=4&amp;modificationDate=1283534469000&amp;api=v2";
 alt="Class Loaders" usemap="#gliffy-map-23527573-7820">
 
-    <map class="gliffy-dynamic" id="gliffy-dynamic-map-23527573-1598" 
name="gliffy-dynamic-map-23527573-1598"></map>
+    <map class="gliffy-dynamic" id="gliffy-dynamic-map-23527573-4485" 
name="gliffy-dynamic-map-23527573-4485"></map>
 </span>
 
 
@@ -117,7 +140,30 @@ public class DBImage
     . . .
   }
 </pre>
-</div></div><p>The compiler will catch a misspelling of the constant 
<code>SUCCESS</code>. Likewise, local constants can be defined for key 
components, such as "loginForm".</p><div class="confluence-information-macro 
confluence-information-macro-information"><span class="aui-icon aui-icon-small 
aui-iconfont-info confluence-information-macro-icon"></span><div 
class="confluence-information-macro-body"><p>Ultimately, it's developer choice. 
HLS prefers the method naming conventions in nearly all cases, especially 
prototypes and demos, but can see that in some projects and some teams, an 
annotation-only approach is best.</p></div></div><h3 
id="PageAndComponentClassesFAQ-WhydoIhavetoinjectapage?Whycan'tIjustcreateoneusingnew?">Why
 do I have to inject a page? Why can't I just create one using 
new?</h3><p>Tapestry tranforms your class at runtime. It tends to build a large 
constructor for the class instance. Further, an instance of the class is 
useless by itself, it must be wired together wi
 th its template and its sub-components.</p><p>On top of that, Tapestry keeps 
just once instance of each page in memory (since 5.2). It reworks the bytecode 
of the components so that a single instance can be shared across multiple 
request handling 
threads.</p><p>____</p><p>&#160;</p><p>&#160;</p><p></p><p></p><p></p><p></p><p></p><p></p><p></p><p><table
 class="Footnotes" style="width: 100%; border:none;" cellspacing="0" 
cellpadding="0" summary="This table contains one or more notes for references 
made elsewhere on the page."><caption 
class="accessibility">Footnotes</caption><thead class="accessibility"><tr 
class="accessibility"><th colspan="1" rowspan="1" class="accessibility" 
id="footnote-th1">Reference</th><th colspan="1" rowspan="1" 
class="accessibility" 
id="footnote-th2">Notes</th></tr></thead><tbody></tbody></table></p><p></p><p></p><p></p><p></p><p></p><p></p><p></p><p>&#160;</p><p>&#160;</p></div>
+</div></div><p>The compiler will catch a misspelling of the constant 
<code>SUCCESS</code>. Likewise, local constants can be defined for key 
components, such as "loginForm".</p><div class="confluence-information-macro 
confluence-information-macro-information"><span class="aui-icon aui-icon-small 
aui-iconfont-info confluence-information-macro-icon"></span><div 
class="confluence-information-macro-body"><p>Ultimately, it's developer choice. 
HLS prefers the method naming conventions in nearly all cases, especially 
prototypes and demos, but can see that in some projects and some teams, an 
annotation-only approach is best.</p></div></div><h3 
id="PageAndComponentClassesFAQ-WhydoIhavetoinjectapage?Whycan'tIjustcreateoneusingnew?">Why
 do I have to inject a page? Why can't I just create one using 
new?</h3><p>Tapestry tranforms your class at runtime. It tends to build a large 
constructor for the class instance. Further, an instance of the class is 
useless by itself, it must be wired together wi
 th its template and its sub-components.</p><p>On top of that, Tapestry keeps 
just once instance of each page in memory (since 5.2). It reworks the bytecode 
of the components so that a single instance can be shared across multiple 
request handling threads.</p>    
+<div class="atb-scrollbar-macro">
+    <div class="prev">
+        <a shape="rect" href="templating-and-markup-faq.html" rel="prev">
+                                    <span class="aui-icon aui-icon-small 
atb-icon-arrow-left">Previous</span>
+                                <span class="title">Templating and Markup 
FAQ</span>
+            </a>
+
+    </div>
+    <div class="parent">
+                    <a shape="rect" href="frequently-asked-questions.html" 
rel="parent">
+                                            <span class="aui-icon 
aui-icon-small atb-icon-arrow-up">Up</span>
+                                        <span class="title">Frequently Asked 
Questions</span>
+                </a>
+
+            </div>
+    <div class="next">
+        <a shape="rect" href="forms-and-form-components-faq.html" rel="next">
+                <span class="title">Forms and Form Components FAQ</span>
+                                    <span class="aui-icon aui-icon-small 
atb-icon-arrow-right">Next</span>
+                            </a>
+
+    </div>
+</div><p>____</p><p>&#160;</p><p>&#160;</p><p></p><p></p><p></p><p></p><p></p><p></p><p></p><p><table
 class="Footnotes" style="width: 100%; border:none;" cellspacing="0" 
cellpadding="0" summary="This table contains one or more notes for references 
made elsewhere on the page."><caption 
class="accessibility">Footnotes</caption><thead class="accessibility"><tr 
class="accessibility"><th colspan="1" rowspan="1" class="accessibility" 
id="footnote-th1">Reference</th><th colspan="1" rowspan="1" 
class="accessibility" 
id="footnote-th2">Notes</th></tr></thead><tbody></tbody></table></p><p></p><p></p><p></p><p></p><p></p><p></p><p></p><p>&#160;</p><p>&#160;</p></div>
 </div>
 
 <div class="clearer"></div>

Modified: websites/production/tapestry/content/release-notes-50.html
==============================================================================
--- websites/production/tapestry/content/release-notes-50.html (original)
+++ websites/production/tapestry/content/release-notes-50.html Sun Nov  8 
17:21:51 2015
@@ -67,17 +67,40 @@
   </div>
 
 <div id="content">
-<div id="ConfluenceContent">
+<div id="ConfluenceContent">    
+<div class="atb-scrollbar-macro">
+    <div class="prev">
+        <a shape="rect" href="how-to-upgrade.html" rel="prev">
+                                    <span class="aui-icon aui-icon-small 
atb-icon-arrow-left">Previous</span>
+                                <span class="title">How to Upgrade</span>
+            </a>
+
+    </div>
+    <div class="parent">
+                    <a shape="rect" href="release-notes.html" rel="parent">
+                                            <span class="aui-icon 
aui-icon-small atb-icon-arrow-up">Up</span>
+                                        <span class="title">Release 
Notes</span>
+                </a>
+
+            </div>
+    <div class="next">
+        <a shape="rect" href="release-notes-51.html" rel="next">
+                <span class="title">Release Notes 5.1</span>
+                                    <span class="aui-icon aui-icon-small 
atb-icon-arrow-right">Next</span>
+                            </a>
+
+    </div>
+</div>
 
 <p>This is the consolidated list of changes between Tapestry versions 5.0.3 
and 5.0.19. Before upgrading, be sure to review the <a shape="rect" 
href="how-to-upgrade.html">How to Upgrade</a> instructions.</p>
 
 <p><strong>Contents</strong></p>
 <style type="text/css">/*<![CDATA[*/
-div.rbtoc1437340848275 {padding: 0px;}
-div.rbtoc1437340848275 ul {list-style: disc;margin-left: 0px;padding-left: 
5px;}
-div.rbtoc1437340848275 li {margin-left: 0px;padding-left: 0px;}
+div.rbtoc1447003262602 {padding: 0px;}
+div.rbtoc1447003262602 ul {list-style: disc;margin-left: 0px;padding-left: 
5px;}
+div.rbtoc1447003262602 li {margin-left: 0px;padding-left: 0px;}
 
-/*]]>*/</style><div class="toc-macro rbtoc1437340848275">
+/*]]>*/</style><div class="toc-macro rbtoc1447003262602">
 <ul class="toc-indentation"><li><a shape="rect" 
href="#ReleaseNotes5.0-TapestryVersion5.0.19">Tapestry Version 
5.0.19</a></li><li><a shape="rect" 
href="#ReleaseNotes5.0-TapestryVersion5.0.18">Tapestry Version 
5.0.18</a></li><li><a shape="rect" 
href="#ReleaseNotes5.0-TapestryVersion5.0.17">Tapestry Version 
5.0.17</a></li><li><a shape="rect" 
href="#ReleaseNotes5.0-TapestryVersion5.0.16">Tapestry Version 
5.0.16</a></li><li><a shape="rect" 
href="#ReleaseNotes5.0-TapestryVersion5.0.15">Tapestry Version 
5.0.15</a></li><li><a shape="rect" 
href="#ReleaseNotes5.0-TapestryVersion5.0.14">Tapestry Version 
5.0.14</a></li><li><a shape="rect" 
href="#ReleaseNotes5.0-TapestryVersion5.0.13">Tapestry Version 
5.0.13</a></li><li><a shape="rect" 
href="#ReleaseNotes5.0-TapestryVersion5.0.12">Tapestry Version 
5.0.12</a></li><li><a shape="rect" 
href="#ReleaseNotes5.0-TapestryVersion5.0.11">Tapestry Version 
5.0.11</a></li><li><a shape="rect" 
href="#ReleaseNotes5.0-TapestryVersion5.0.10">Tapestry Version 5.0.
 10</a></li><li><a shape="rect" 
href="#ReleaseNotes5.0-TapestryVersion5.0.9">Tapestry Version 
5.0.9</a></li><li><a shape="rect" 
href="#ReleaseNotes5.0-TapestryVersion5.0.8">Tapestry Version 
5.0.8</a></li><li><a shape="rect" 
href="#ReleaseNotes5.0-TapestryVersion5.0.7">Tapestry Version 
5.0.7</a></li><li><a shape="rect" 
href="#ReleaseNotes5.0-TapestryVersion5.0.6">Tapestry Version 
5.0.6</a></li><li><a shape="rect" 
href="#ReleaseNotes5.0-TapestryVersion5.0.5">Tapestry Version 
5.0.5</a></li><li><a shape="rect" 
href="#ReleaseNotes5.0-TapestryVersion5.0.4">Tapestry Version 
5.0.4</a></li><li><a shape="rect" 
href="#ReleaseNotes5.0-TapestryVersion5.0.3">Tapestry Version 
5.0.3</a></li></ul>
 </div>
 
@@ -421,7 +444,31 @@ div.rbtoc1437340848275 li {margin-left:
 
 <ul><li><a shape="rect" class="external-link" 
href="https://issues.apache.org/jira/browse/TAPESTRY-1276";>TAPESTRY-1276</a> 
&#8211; If component should include an optional negate parameter</li><li><a 
shape="rect" class="external-link" 
href="https://issues.apache.org/jira/browse/TAPESTRY-1284";>TAPESTRY-1284</a> 
&#8211; Tapestry Spring integration module</li><li><a shape="rect" 
class="external-link" 
href="https://issues.apache.org/jira/browse/TAPESTRY-1292";>TAPESTRY-1292</a> 
&#8211; Allow lists to be used as select models</li><li><a shape="rect" 
class="external-link" 
href="https://issues.apache.org/jira/browse/TAPESTRY-1302";>TAPESTRY-1302</a> 
&#8211; JavaScript support</li><li><a shape="rect" class="external-link" 
href="https://issues.apache.org/jira/browse/TAPESTRY-1311";>TAPESTRY-1311</a> 
&#8211; Identify type of component via tag element name in templates</li><li><a 
shape="rect" class="external-link" 
href="https://issues.apache.org/jira/browse/TAPESTRY-1319";>TAPESTRY-1319</a> 
&#8211;
  tapestry.InfrastructureOverrides is not yet implemented</li><li><a 
shape="rect" class="external-link" 
href="https://issues.apache.org/jira/browse/TAPESTRY-1325";>TAPESTRY-1325</a> 
&#8211; Add an "asset:" object provider, to simplfy injecting assets into 
services</li><li><a shape="rect" class="external-link" 
href="https://issues.apache.org/jira/browse/TAPESTRY-1341";>TAPESTRY-1341</a> 
&#8211; Allow service builders named "build" and determine service id from the 
result type</li></ul>
 
-</div>
+
+    
+<div class="atb-scrollbar-macro">
+    <div class="prev">
+        <a shape="rect" href="how-to-upgrade.html" rel="prev">
+                                    <span class="aui-icon aui-icon-small 
atb-icon-arrow-left">Previous</span>
+                                <span class="title">How to Upgrade</span>
+            </a>
+
+    </div>
+    <div class="parent">
+                    <a shape="rect" href="release-notes.html" rel="parent">
+                                            <span class="aui-icon 
aui-icon-small atb-icon-arrow-up">Up</span>
+                                        <span class="title">Release 
Notes</span>
+                </a>
+
+            </div>
+    <div class="next">
+        <a shape="rect" href="release-notes-51.html" rel="next">
+                <span class="title">Release Notes 5.1</span>
+                                    <span class="aui-icon aui-icon-small 
atb-icon-arrow-right">Next</span>
+                            </a>
+
+    </div>
+</div></div>
 </div>
 
 <div class="clearer"></div>

Modified: websites/production/tapestry/content/release-notes-51.html
==============================================================================
--- websites/production/tapestry/content/release-notes-51.html (original)
+++ websites/production/tapestry/content/release-notes-51.html Sun Nov  8 
17:21:51 2015
@@ -67,17 +67,40 @@
   </div>
 
 <div id="content">
-<div id="ConfluenceContent">
+<div id="ConfluenceContent">    
+<div class="atb-scrollbar-macro">
+    <div class="prev">
+        <a shape="rect" href="release-notes-50.html" rel="prev">
+                                    <span class="aui-icon aui-icon-small 
atb-icon-arrow-left">Previous</span>
+                                <span class="title">Release Notes 5.0</span>
+            </a>
+
+    </div>
+    <div class="parent">
+                    <a shape="rect" href="release-notes.html" rel="parent">
+                                            <span class="aui-icon 
aui-icon-small atb-icon-arrow-up">Up</span>
+                                        <span class="title">Release 
Notes</span>
+                </a>
+
+            </div>
+    <div class="next">
+        <a shape="rect" href="release-notes-52.html" rel="next">
+                <span class="title">Release Notes 5.2</span>
+                                    <span class="aui-icon aui-icon-small 
atb-icon-arrow-right">Next</span>
+                            </a>
+
+    </div>
+</div>
 
 <p>This is the consolidated list of changes between Tapestry versions 5.0 and 
5.1. Before upgrading, be sure to review the <a shape="rect" 
href="how-to-upgrade.html">How to Upgrade</a> instructions.</p>
 
 <p><strong>Contents</strong></p>
 <style type="text/css">/*<![CDATA[*/
-div.rbtoc1437340791870 {padding: 0px;}
-div.rbtoc1437340791870 ul {list-style: disc;margin-left: 0px;}
-div.rbtoc1437340791870 li {margin-left: 0px;padding-left: 0px;}
+div.rbtoc1447003195363 {padding: 0px;}
+div.rbtoc1447003195363 ul {list-style: disc;margin-left: 0px;}
+div.rbtoc1447003195363 li {margin-left: 0px;padding-left: 0px;}
 
-/*]]>*/</style><div class="toc-macro rbtoc1437340791870">
+/*]]>*/</style><div class="toc-macro rbtoc1447003195363">
 <ul class="toc-indentation"><li><a shape="rect" 
href="#ReleaseNotes5.1-TapestryVersion5.1.0.5">Tapestry Version 
5.1.0.5</a></li><li><a shape="rect" 
href="#ReleaseNotes5.1-TapestryVersion5.1.0.4">Tapestry Version 
5.1.0.4</a></li><li><a shape="rect" 
href="#ReleaseNotes5.1-TapestryVersion5.1.0.3">Tapestry Version 
5.1.0.3</a></li><li><a shape="rect" 
href="#ReleaseNotes5.1-TapestryVersion5.1.0.2">Tapestry Version 
5.1.0.2</a></li><li><a shape="rect" 
href="#ReleaseNotes5.1-TapestryVersion5.1.0.1">Tapestry Version 
5.1.0.1</a></li><li><a shape="rect" 
href="#ReleaseNotes5.1-TapestryVersion5.1.0.0">Tapestry Version 
5.1.0.0</a></li></ul>
 </div>
 
@@ -207,7 +230,31 @@ div.rbtoc1437340791870 li {margin-left:
 
 <ul><li><a shape="rect" class="external-link" 
href="https://issues.apache.org/jira/browse/TAP5-372";>TAP5-372</a> &#8211; 
Merge changes from 5.0.16 --&gt; 5.0.17 into trunk (5.1)</li><li><a 
shape="rect" class="external-link" 
href="https://issues.apache.org/jira/browse/TAP5-379";>TAP5-379</a> &#8211; Add 
the Ars Machina Project to the list of Tapestry 5-related packages</li><li><a 
shape="rect" class="external-link" 
href="https://issues.apache.org/jira/browse/TAP5-381";>TAP5-381</a> &#8211; 
Documentation talks about a "tapestry.charset" when there's no such 
configuration documented</li><li><a shape="rect" class="external-link" 
href="https://issues.apache.org/jira/browse/TAP5-480";>TAP5-480</a> &#8211; 
Upgrade Surefire Plugin and TestNG dependencies to latest version (2.4.3 and 
5.8, respectively)</li><li><a shape="rect" class="external-link" 
href="https://issues.apache.org/jira/browse/TAP5-493";>TAP5-493</a> &#8211; 
Translate StructureStrings#original-child-component</li><li><a shape="rect"
  class="external-link" 
href="https://issues.apache.org/jira/browse/TAP5-494";>TAP5-494</a> &#8211; 
Downgrade maven-site-plugin from 2.0-beta-6 to 2.0-beta-5 because we prefer a 
site that actually works</li></ul>
 
-</div>
+
+    
+<div class="atb-scrollbar-macro">
+    <div class="prev">
+        <a shape="rect" href="release-notes-50.html" rel="prev">
+                                    <span class="aui-icon aui-icon-small 
atb-icon-arrow-left">Previous</span>
+                                <span class="title">Release Notes 5.0</span>
+            </a>
+
+    </div>
+    <div class="parent">
+                    <a shape="rect" href="release-notes.html" rel="parent">
+                                            <span class="aui-icon 
aui-icon-small atb-icon-arrow-up">Up</span>
+                                        <span class="title">Release 
Notes</span>
+                </a>
+
+            </div>
+    <div class="next">
+        <a shape="rect" href="release-notes-52.html" rel="next">
+                <span class="title">Release Notes 5.2</span>
+                                    <span class="aui-icon aui-icon-small 
atb-icon-arrow-right">Next</span>
+                            </a>
+
+    </div>
+</div></div>
 </div>
 
 <div class="clearer"></div>

Modified: websites/production/tapestry/content/release-notes-52.html
==============================================================================
--- websites/production/tapestry/content/release-notes-52.html (original)
+++ websites/production/tapestry/content/release-notes-52.html Sun Nov  8 
17:21:51 2015
@@ -68,12 +68,35 @@
   </div>
 
 <div id="content">
-<div id="ConfluenceContent"><p>This is the consolidated list of changes 
between Tapestry versions 5.1 and 5.2. To upgrade from 5.1 to 5.2, most users 
will be able to just update the Maven dependency in their POM file (or <a 
shape="rect" href="download.html">download</a> the new JAR file) and the new 
version will just work. However, please read carefully below before upgrading, 
and also review the <a shape="rect" href="how-to-upgrade.html">How to 
Upgrade</a> instructions.</p><p><strong>Contents</strong></p><p><style 
type="text/css">/*<![CDATA[*/
-div.rbtoc1437340824369 {padding: 0px;}
-div.rbtoc1437340824369 ul {list-style: disc;margin-left: 0px;}
-div.rbtoc1437340824369 li {margin-left: 0px;padding-left: 0px;}
+<div id="ConfluenceContent">    
+<div class="atb-scrollbar-macro">
+    <div class="prev">
+        <a shape="rect" href="release-notes-51.html" rel="prev">
+                                    <span class="aui-icon aui-icon-small 
atb-icon-arrow-left">Previous</span>
+                                <span class="title">Release Notes 5.1</span>
+            </a>
+
+    </div>
+    <div class="parent">
+                    <a shape="rect" href="release-notes.html" rel="parent">
+                                            <span class="aui-icon 
aui-icon-small atb-icon-arrow-up">Up</span>
+                                        <span class="title">Release 
Notes</span>
+                </a>
+
+            </div>
+    <div class="next">
+        <a shape="rect" href="release-notes-53.html" rel="next">
+                <span class="title">Release Notes 5.3</span>
+                                    <span class="aui-icon aui-icon-small 
atb-icon-arrow-right">Next</span>
+                            </a>
+
+    </div>
+</div><p>This is the consolidated list of changes between Tapestry versions 
5.1 and 5.2. To upgrade from 5.1 to 5.2, most users will be able to just update 
the Maven dependency in their POM file (or <a shape="rect" 
href="download.html">download</a> the new JAR file) and the new version will 
just work. However, please read carefully below before upgrading, and also 
review the <a shape="rect" href="how-to-upgrade.html">How to Upgrade</a> 
instructions.</p><p><strong>Contents</strong></p><p><style 
type="text/css">/*<![CDATA[*/
+div.rbtoc1447003233865 {padding: 0px;}
+div.rbtoc1447003233865 ul {list-style: disc;margin-left: 0px;}
+div.rbtoc1447003233865 li {margin-left: 0px;padding-left: 0px;}
 
-/*]]>*/</style></p><div class="toc-macro rbtoc1437340824369">
+/*]]>*/</style></p><div class="toc-macro rbtoc1447003233865">
 <ul class="toc-indentation"><li><a shape="rect" 
href="#ReleaseNotes5.2-BreakingChanges">Breaking Changes</a></li><li><a 
shape="rect" href="#ReleaseNotes5.2-ReleaseNotes:Tapestry5.2.6">Release Notes: 
Tapestry 5.2.6</a></li><li><a shape="rect" 
href="#ReleaseNotes5.2-ReleaseNotes:Tapestry5.2.5">Release Notes: Tapestry 
5.2.5</a></li><li><a shape="rect" 
href="#ReleaseNotes5.2-ReleaseNotes:Tapestry5.2.4">Release Notes: Tapestry 
5.2.4</a></li><li><a shape="rect" 
href="#ReleaseNotes5.2-ReleaseNotes:Tapestry5.2.3">Release Notes: Tapestry 
5.2.3</a></li><li><a shape="rect" 
href="#ReleaseNotes5.2-ReleaseNotes:Tapestry5.2.2">Release Notes: Tapestry 
5.2.2</a></li><li><a shape="rect" 
href="#ReleaseNotes5.2-ReleaseNotes:Tapestry5.2.1">Release Notes: Tapestry 
5.2.1</a></li><li><a shape="rect" 
href="#ReleaseNotes5.2-ReleaseNotes:Tapestry5.2.0">Release Notes: Tapestry 
5.2.0</a></li></ul>
 </div><h2 id="ReleaseNotes5.2-BreakingChanges">Breaking Changes</h2><p>The 
following changes have been made in Tapestry 5.2 that are likely to result in 
unexpected behavior if your application relies on the changed functionality. 
Please review this list carefully before upgrading from 5.1 to 5.2. Also check 
the <a shape="rect" class="external-link" 
href="http://tapestry.apache.org/current/apidocs/deprecated-list.html";>Deprecated
 API List</a> for non-breaking changes.</p><ul><li>Page classes with instance 
variables that are not thread safe must be created in a method rather than 
declared as an instance variable. For example, creating an instance variable 
<code>private final DateFormat format = 
DateFormat.getDateInstance(DateFormat.MEDIUM, locale);</code> in a page and 
using it will cause problems because DateFormat is not thread safe. Instead, 
you must create the DateFormat in a method. See <a shape="rect" 
href="release-notes-52.html">Release Notes: Tapestry 5.2.0</a> (below) for det
 ails.</li><li><a shape="rect" class="external-link" 
href="http://tapestry.apache.org/current/apidocs/org/apache/tapestry5/Link.html#toAbsoluteURI%28%29";>Link.toAbsoluteURI()</a>
 now returns the absolute URL, which includes the scheme, hostname and possibly 
port (e.g., "http://example.com:8080/myapp/viewproduct/4";), rather than a 
relative URL (e.g., "/myapp/viewproduct/4"). See <a shape="rect" 
href="release-notes-52.html">Release Notes: Tapestry 5.2.2</a> (below) for 
details.</li><li>The <a shape="rect" class="external-link" 
href="http://tapestry.apache.org/tapestry5.2-dev/tapestry-core/ref/org/apache/tapestry5/corelib/components/Label.html";>Label</a>
 component no longer outputs an id:</li></ul><p>Previously valid code in 
5.1.0.5:</p><div class="code panel pdl" style="border-width: 1px;"><div 
class="codeContent panelContent pdl">
 <pre class="brush: xml; gutter: false; theme: Default" 
style="font-size:12px;">&lt;t:form&gt;&lt;t:label 
for="search"/&gt;&lt;t:textfield t:id="search" 
size="50"/&gt;&lt;/t:form&gt;</pre>
@@ -263,7 +286,30 @@ built-in translators. This will break ex
 <h3 id="ReleaseNotes5.2-TasksCompleted.2">Tasks Completed</h3>
 
 <ul><li><a shape="rect" class="external-link" 
href="https://issues.apache.org/jira/browse/TAP5-11";>TAP5-11</a> &#8211; 
CookiesImplTest does specify a domain cookie with a domain not prefixed with a 
. (dot)</li><li><a shape="rect" class="external-link" 
href="https://issues.apache.org/jira/browse/TAP5-556";>TAP5-556</a> &#8211; Fix 
TranslatorSourceImplTest</li><li><a shape="rect" class="external-link" 
href="https://issues.apache.org/jira/browse/TAP5-756";>TAP5-756</a> &#8211; Add 
ioko-tapestry-commons to the related projects list</li><li><a shape="rect" 
class="external-link" 
href="https://issues.apache.org/jira/browse/TAP5-819";>TAP5-819</a> &#8211; 
remove ide-specific files from all sub-modules and add them to 
svn:ignore</li><li><a shape="rect" class="external-link" 
href="https://issues.apache.org/jira/browse/TAP5-969";>TAP5-969</a> &#8211; 
Method AbstractField.createDefaultParameterBinding() should be 
deprecated</li><li><a shape="rect" class="external-link" 
href="https://issues.apache.o
 rg/jira/browse/TAP5-976">TAP5-976</a> &#8211; Upgrade Spring dependencies to 
version 3.0.0.RELEASE</li><li><a shape="rect" class="external-link" 
href="https://issues.apache.org/jira/browse/TAP5-1081";>TAP5-1081</a> &#8211; 
Remove formos references from 5.2.0 archetype</li><li><a shape="rect" 
class="external-link" 
href="https://issues.apache.org/jira/browse/TAP5-1087";>TAP5-1087</a> &#8211; 
Upgrade TestNG dependencies to version 5.12.1</li><li><a shape="rect" 
class="external-link" 
href="https://issues.apache.org/jira/browse/TAP5-1134";>TAP5-1134</a> &#8211; 
Upgrade Hibernate dependencies to 3.5.2</li><li><a shape="rect" 
class="external-link" 
href="https://issues.apache.org/jira/browse/TAP5-1195";>TAP5-1195</a> &#8211; 
Rename annotations @QueryParameter and @QueryParameterMapped (both introduced 
in 5.2.0) to more mnemonic names</li></ul>
-</div>
+    
+<div class="atb-scrollbar-macro">
+    <div class="prev">
+        <a shape="rect" href="release-notes-51.html" rel="prev">
+                                    <span class="aui-icon aui-icon-small 
atb-icon-arrow-left">Previous</span>
+                                <span class="title">Release Notes 5.1</span>
+            </a>
+
+    </div>
+    <div class="parent">
+                    <a shape="rect" href="release-notes.html" rel="parent">
+                                            <span class="aui-icon 
aui-icon-small atb-icon-arrow-up">Up</span>
+                                        <span class="title">Release 
Notes</span>
+                </a>
+
+            </div>
+    <div class="next">
+        <a shape="rect" href="release-notes-53.html" rel="next">
+                <span class="title">Release Notes 5.3</span>
+                                    <span class="aui-icon aui-icon-small 
atb-icon-arrow-right">Next</span>
+                            </a>
+
+    </div>
+</div></div>
 </div>
 
 <div class="clearer"></div>

Modified: websites/production/tapestry/content/release-notes-53.html
==============================================================================
--- websites/production/tapestry/content/release-notes-53.html (original)
+++ websites/production/tapestry/content/release-notes-53.html Sun Nov  8 
17:21:51 2015
@@ -67,17 +67,40 @@
   </div>
 
 <div id="content">
-<div id="ConfluenceContent">
+<div id="ConfluenceContent">    
+<div class="atb-scrollbar-macro">
+    <div class="prev">
+        <a shape="rect" href="release-notes-52.html" rel="prev">
+                                    <span class="aui-icon aui-icon-small 
atb-icon-arrow-left">Previous</span>
+                                <span class="title">Release Notes 5.2</span>
+            </a>
+
+    </div>
+    <div class="parent">
+                    <a shape="rect" href="release-notes.html" rel="parent">
+                                            <span class="aui-icon 
aui-icon-small atb-icon-arrow-up">Up</span>
+                                        <span class="title">Release 
Notes</span>
+                </a>
+
+            </div>
+    <div class="next">
+        <a shape="rect" href="release-notes-531.html" rel="next">
+                <span class="title">Release Notes 5.3.1</span>
+                                    <span class="aui-icon aui-icon-small 
atb-icon-arrow-right">Next</span>
+                            </a>
+
+    </div>
+</div>
 
 <p>This is the consolidated list of changes between Tapestry versions 5.2 and 
5.3.  To upgrade from 5.2 to 5.3, most users who are not using deprecated 
features will be able to just update the Maven dependency in their POM file (or 
<a shape="rect" href="download.html">download</a> the new JAR file) and the new 
version will just work.  However, please read carefully below before upgrading, 
and also review the <a shape="rect" href="how-to-upgrade.html">How to 
Upgrade</a> instructions.</p>
 
 <p><strong>Contents</strong></p>
 <style type="text/css">/*<![CDATA[*/
-div.rbtoc1437340812101 {padding: 0px;}
-div.rbtoc1437340812101 ul {list-style: disc;margin-left: 0px;}
-div.rbtoc1437340812101 li {margin-left: 0px;padding-left: 0px;}
+div.rbtoc1447003219213 {padding: 0px;}
+div.rbtoc1447003219213 ul {list-style: disc;margin-left: 0px;}
+div.rbtoc1447003219213 li {margin-left: 0px;padding-left: 0px;}
 
-/*]]>*/</style><div class="toc-macro rbtoc1437340812101">
+/*]]>*/</style><div class="toc-macro rbtoc1447003219213">
 <ul class="toc-indentation"><li><a shape="rect" 
href="#ReleaseNotes5.3-BreakingChanges">Breaking Changes</a></li><li><a 
shape="rect" href="#ReleaseNotes5.3-NewFeatures">New Features</a></li><li><a 
shape="rect" href="#ReleaseNotes5.3-Sub-tasksCompleted">Sub-tasks 
Completed</a></li><li><a shape="rect" href="#ReleaseNotes5.3-BugsFixed">Bugs 
Fixed</a></li><li><a shape="rect" 
href="#ReleaseNotes5.3-ImprovementsMade">Improvements Made</a></li><li><a 
shape="rect" href="#ReleaseNotes5.3-NewFeaturesImplemented">New Features 
Implemented</a></li><li><a shape="rect" 
href="#ReleaseNotes5.3-TasksCompleted">Tasks Completed</a></li></ul>
 </div> 
 
@@ -501,7 +524,31 @@ div.rbtoc1437340812101 li {margin-left:
 <p></p>
 
 <p></p><p></p><p></p>
-</div>
+
+    
+<div class="atb-scrollbar-macro">
+    <div class="prev">
+        <a shape="rect" href="release-notes-52.html" rel="prev">
+                                    <span class="aui-icon aui-icon-small 
atb-icon-arrow-left">Previous</span>
+                                <span class="title">Release Notes 5.2</span>
+            </a>
+
+    </div>
+    <div class="parent">
+                    <a shape="rect" href="release-notes.html" rel="parent">
+                                            <span class="aui-icon 
aui-icon-small atb-icon-arrow-up">Up</span>
+                                        <span class="title">Release 
Notes</span>
+                </a>
+
+            </div>
+    <div class="next">
+        <a shape="rect" href="release-notes-531.html" rel="next">
+                <span class="title">Release Notes 5.3.1</span>
+                                    <span class="aui-icon aui-icon-small 
atb-icon-arrow-right">Next</span>
+                            </a>
+
+    </div>
+</div></div>
 </div>
 
 <div class="clearer"></div>

Modified: websites/production/tapestry/content/release-notes-531.html
==============================================================================
--- websites/production/tapestry/content/release-notes-531.html (original)
+++ websites/production/tapestry/content/release-notes-531.html Sun Nov  8 
17:21:51 2015
@@ -67,7 +67,30 @@
   </div>
 
 <div id="content">
-<div id="ConfluenceContent">
+<div id="ConfluenceContent">    
+<div class="atb-scrollbar-macro">
+    <div class="prev">
+        <a shape="rect" href="release-notes-53.html" rel="prev">
+                                    <span class="aui-icon aui-icon-small 
atb-icon-arrow-left">Previous</span>
+                                <span class="title">Release Notes 5.3</span>
+            </a>
+
+    </div>
+    <div class="parent">
+                    <a shape="rect" href="release-notes.html" rel="parent">
+                                            <span class="aui-icon 
aui-icon-small atb-icon-arrow-up">Up</span>
+                                        <span class="title">Release 
Notes</span>
+                </a>
+
+            </div>
+    <div class="next">
+        <a shape="rect" href="release-notes-532.html" rel="next">
+                <span class="title">Release Notes 5.3.2</span>
+                                    <span class="aui-icon aui-icon-small 
atb-icon-arrow-right">Next</span>
+                            </a>
+
+    </div>
+</div>
 
 <p>This bugfix release is a drop-in replacement for the <a shape="rect" 
href="release-notes-53.html">5.3</a> release. Any 5.3 user is encouraged to 
upgrade. Be sure to review the <a shape="rect" href="how-to-upgrade.html">How 
to Upgrade</a> instructions first, though.</p>
 
@@ -93,7 +116,31 @@
 
 <p></p>
 
-</div>
+
+    
+<div class="atb-scrollbar-macro">
+    <div class="prev">
+        <a shape="rect" href="release-notes-53.html" rel="prev">
+                                    <span class="aui-icon aui-icon-small 
atb-icon-arrow-left">Previous</span>
+                                <span class="title">Release Notes 5.3</span>
+            </a>
+
+    </div>
+    <div class="parent">
+                    <a shape="rect" href="release-notes.html" rel="parent">
+                                            <span class="aui-icon 
aui-icon-small atb-icon-arrow-up">Up</span>
+                                        <span class="title">Release 
Notes</span>
+                </a>
+
+            </div>
+    <div class="next">
+        <a shape="rect" href="release-notes-532.html" rel="next">
+                <span class="title">Release Notes 5.3.2</span>
+                                    <span class="aui-icon aui-icon-small 
atb-icon-arrow-right">Next</span>
+                            </a>
+
+    </div>
+</div></div>
 </div>
 
 <div class="clearer"></div>

Modified: websites/production/tapestry/content/release-notes-532.html
==============================================================================
--- websites/production/tapestry/content/release-notes-532.html (original)
+++ websites/production/tapestry/content/release-notes-532.html Sun Nov  8 
17:21:51 2015
@@ -67,7 +67,30 @@
   </div>
 
 <div id="content">
-<div id="ConfluenceContent"> 
+<div id="ConfluenceContent">    
+<div class="atb-scrollbar-macro">
+    <div class="prev">
+        <a shape="rect" href="release-notes-531.html" rel="prev">
+                                    <span class="aui-icon aui-icon-small 
atb-icon-arrow-left">Previous</span>
+                                <span class="title">Release Notes 5.3.1</span>
+            </a>
+
+    </div>
+    <div class="parent">
+                    <a shape="rect" href="release-notes.html" rel="parent">
+                                            <span class="aui-icon 
aui-icon-small atb-icon-arrow-up">Up</span>
+                                        <span class="title">Release 
Notes</span>
+                </a>
+
+            </div>
+    <div class="next">
+        <a shape="rect" href="release-notes-533.html" rel="next">
+                <span class="title">Release Notes 5.3.3</span>
+                                    <span class="aui-icon aui-icon-small 
atb-icon-arrow-right">Next</span>
+                            </a>
+
+    </div>
+</div> 
 
 <p>This is the consolidated list of changes between Tapestry versions 5.3.1 
and 5.3.2. To upgrade, just update the Maven dependency in you POM file (or <a 
shape="rect" href="download.html">download</a> the new JAR file) and the new 
version will just work. However, please review the <a shape="rect" 
href="how-to-upgrade.html">How to Upgrade</a> instructions before upgrading. 
And be sure to check the <a shape="rect" href="release-notes-53.html">Release 
Notes for 5.3</a> and <a shape="rect" href="release-notes-531.html">Release 
Notes for 5.3.1</a> too.</p>
 
@@ -102,7 +125,31 @@
 </li></ul>
 
 <p></p>
-</div>
+
+    
+<div class="atb-scrollbar-macro">
+    <div class="prev">
+        <a shape="rect" href="release-notes-531.html" rel="prev">
+                                    <span class="aui-icon aui-icon-small 
atb-icon-arrow-left">Previous</span>
+                                <span class="title">Release Notes 5.3.1</span>
+            </a>
+
+    </div>
+    <div class="parent">
+                    <a shape="rect" href="release-notes.html" rel="parent">
+                                            <span class="aui-icon 
aui-icon-small atb-icon-arrow-up">Up</span>
+                                        <span class="title">Release 
Notes</span>
+                </a>
+
+            </div>
+    <div class="next">
+        <a shape="rect" href="release-notes-533.html" rel="next">
+                <span class="title">Release Notes 5.3.3</span>
+                                    <span class="aui-icon aui-icon-small 
atb-icon-arrow-right">Next</span>
+                            </a>
+
+    </div>
+</div></div>
 </div>
 
 <div class="clearer"></div>

Modified: websites/production/tapestry/content/release-notes-533.html
==============================================================================
--- websites/production/tapestry/content/release-notes-533.html (original)
+++ websites/production/tapestry/content/release-notes-533.html Sun Nov  8 
17:21:51 2015
@@ -67,7 +67,30 @@
   </div>
 
 <div id="content">
-<div id="ConfluenceContent"> 
+<div id="ConfluenceContent">    
+<div class="atb-scrollbar-macro">
+    <div class="prev">
+        <a shape="rect" href="release-notes-532.html" rel="prev">
+                                    <span class="aui-icon aui-icon-small 
atb-icon-arrow-left">Previous</span>
+                                <span class="title">Release Notes 5.3.2</span>
+            </a>
+
+    </div>
+    <div class="parent">
+                    <a shape="rect" href="release-notes.html" rel="parent">
+                                            <span class="aui-icon 
aui-icon-small atb-icon-arrow-up">Up</span>
+                                        <span class="title">Release 
Notes</span>
+                </a>
+
+            </div>
+    <div class="next">
+        <a shape="rect" href="release-notes-534.html" rel="next">
+                <span class="title">Release Notes 5.3.4</span>
+                                    <span class="aui-icon aui-icon-small 
atb-icon-arrow-right">Next</span>
+                            </a>
+
+    </div>
+</div> 
 
 <p>This is the consolidated list of changes between Tapestry versions 5.3.2 
and 5.3.3. Tapestry 5.3.3 is a drop-in replacement for prior Tapestry 5.3 
releases. To upgrade, just update the Maven dependency in you POM file (or <a 
shape="rect" href="download.html">download</a> the new JAR file) and the new 
version will just work. However, please review the <a shape="rect" 
href="how-to-upgrade.html">How to Upgrade</a> instructions before upgrading. 
</p>
 
@@ -98,7 +121,31 @@
                             
                    
  <p></p>
-</div>
+
+    
+<div class="atb-scrollbar-macro">
+    <div class="prev">
+        <a shape="rect" href="release-notes-532.html" rel="prev">
+                                    <span class="aui-icon aui-icon-small 
atb-icon-arrow-left">Previous</span>
+                                <span class="title">Release Notes 5.3.2</span>
+            </a>
+
+    </div>
+    <div class="parent">
+                    <a shape="rect" href="release-notes.html" rel="parent">
+                                            <span class="aui-icon 
aui-icon-small atb-icon-arrow-up">Up</span>
+                                        <span class="title">Release 
Notes</span>
+                </a>
+
+            </div>
+    <div class="next">
+        <a shape="rect" href="release-notes-534.html" rel="next">
+                <span class="title">Release Notes 5.3.4</span>
+                                    <span class="aui-icon aui-icon-small 
atb-icon-arrow-right">Next</span>
+                            </a>
+
+    </div>
+</div></div>
 </div>
 
 <div class="clearer"></div>

Modified: websites/production/tapestry/content/release-notes-534.html
==============================================================================
--- websites/production/tapestry/content/release-notes-534.html (original)
+++ websites/production/tapestry/content/release-notes-534.html Sun Nov  8 
17:21:51 2015
@@ -67,7 +67,30 @@
   </div>
 
 <div id="content">
-<div id="ConfluenceContent"> 
+<div id="ConfluenceContent">    
+<div class="atb-scrollbar-macro">
+    <div class="prev">
+        <a shape="rect" href="release-notes-533.html" rel="prev">
+                                    <span class="aui-icon aui-icon-small 
atb-icon-arrow-left">Previous</span>
+                                <span class="title">Release Notes 5.3.3</span>
+            </a>
+
+    </div>
+    <div class="parent">
+                    <a shape="rect" href="release-notes.html" rel="parent">
+                                            <span class="aui-icon 
aui-icon-small atb-icon-arrow-up">Up</span>
+                                        <span class="title">Release 
Notes</span>
+                </a>
+
+            </div>
+    <div class="next">
+        <a shape="rect" href="release-notes-535.html" rel="next">
+                <span class="title">Release Notes 5.3.5</span>
+                                    <span class="aui-icon aui-icon-small 
atb-icon-arrow-right">Next</span>
+                            </a>
+
+    </div>
+</div> 
 
 <p>This is the consolidated list of changes between Tapestry versions 5.3.3 
and 5.3.4. Tapestry 5.3.4 is a drop-in replacement for prior Tapestry 5.3 
releases. To upgrade, just update the Maven dependency in you POM file (or <a 
shape="rect" href="download.html">download</a> the new JAR file) and the new 
version will just work. However, please review the <a shape="rect" 
href="how-to-upgrade.html">How to Upgrade</a> instructions before upgrading. 
</p>
 
@@ -98,7 +121,31 @@
 </li></ul>
                                 
 <p></p>
-</div>
+
+    
+<div class="atb-scrollbar-macro">
+    <div class="prev">
+        <a shape="rect" href="release-notes-533.html" rel="prev">
+                                    <span class="aui-icon aui-icon-small 
atb-icon-arrow-left">Previous</span>
+                                <span class="title">Release Notes 5.3.3</span>
+            </a>
+
+    </div>
+    <div class="parent">
+                    <a shape="rect" href="release-notes.html" rel="parent">
+                                            <span class="aui-icon 
aui-icon-small atb-icon-arrow-up">Up</span>
+                                        <span class="title">Release 
Notes</span>
+                </a>
+
+            </div>
+    <div class="next">
+        <a shape="rect" href="release-notes-535.html" rel="next">
+                <span class="title">Release Notes 5.3.5</span>
+                                    <span class="aui-icon aui-icon-small 
atb-icon-arrow-right">Next</span>
+                            </a>
+
+    </div>
+</div></div>
 </div>
 
 <div class="clearer"></div>

Modified: websites/production/tapestry/content/release-notes-535.html
==============================================================================
--- websites/production/tapestry/content/release-notes-535.html (original)
+++ websites/production/tapestry/content/release-notes-535.html Sun Nov  8 
17:21:51 2015
@@ -67,7 +67,30 @@
   </div>
 
 <div id="content">
-<div id="ConfluenceContent"> 
+<div id="ConfluenceContent">    
+<div class="atb-scrollbar-macro">
+    <div class="prev">
+        <a shape="rect" href="release-notes-534.html" rel="prev">
+                                    <span class="aui-icon aui-icon-small 
atb-icon-arrow-left">Previous</span>
+                                <span class="title">Release Notes 5.3.4</span>
+            </a>
+
+    </div>
+    <div class="parent">
+                    <a shape="rect" href="release-notes.html" rel="parent">
+                                            <span class="aui-icon 
aui-icon-small atb-icon-arrow-up">Up</span>
+                                        <span class="title">Release 
Notes</span>
+                </a>
+
+            </div>
+    <div class="next">
+        <a shape="rect" href="release-notes-536.html" rel="next">
+                <span class="title">Release Notes 5.3.6</span>
+                                    <span class="aui-icon aui-icon-small 
atb-icon-arrow-right">Next</span>
+                            </a>
+
+    </div>
+</div> 
 <p></p><p></p><p></p><p></p><p></p><p></p><p></p><p></p><p></p><p></p><p></p>
 
 <p>This is the consolidated list of changes between Tapestry included in 
version 5.3.5. Tapestry 5.3.5 is a drop-in replacement for prior Tapestry 5.3 
releases. To upgrade, just update the Maven dependency in you POM file (or <a 
shape="rect" href="download.html">download</a> the new JAR file) and the new 
version will just work. However, please review the <a shape="rect" 
href="how-to-upgrade.html">How to Upgrade</a> instructions before upgrading. 
</p>
@@ -100,7 +123,31 @@
 <ul><li>[<a shape="rect" 
href="https://issues.apache.org/jira/browse/TAP5-1989";>TAP5-1989</a>] -         
Upgrade bundled Prototype to version 1.7.1
 </li></ul>
                     
-                    <p></p></div>
+                    <p></p>
+    
+<div class="atb-scrollbar-macro">
+    <div class="prev">
+        <a shape="rect" href="release-notes-534.html" rel="prev">
+                                    <span class="aui-icon aui-icon-small 
atb-icon-arrow-left">Previous</span>
+                                <span class="title">Release Notes 5.3.4</span>
+            </a>
+
+    </div>
+    <div class="parent">
+                    <a shape="rect" href="release-notes.html" rel="parent">
+                                            <span class="aui-icon 
aui-icon-small atb-icon-arrow-up">Up</span>
+                                        <span class="title">Release 
Notes</span>
+                </a>
+
+            </div>
+    <div class="next">
+        <a shape="rect" href="release-notes-536.html" rel="next">
+                <span class="title">Release Notes 5.3.6</span>
+                                    <span class="aui-icon aui-icon-small 
atb-icon-arrow-right">Next</span>
+                            </a>
+
+    </div>
+</div></div>
 </div>
 
 <div class="clearer"></div>

Modified: websites/production/tapestry/content/release-notes-536.html
==============================================================================
--- websites/production/tapestry/content/release-notes-536.html (original)
+++ websites/production/tapestry/content/release-notes-536.html Sun Nov  8 
17:21:51 2015
@@ -67,7 +67,30 @@
   </div>
 
 <div id="content">
-<div id="ConfluenceContent"> 
+<div id="ConfluenceContent">    
+<div class="atb-scrollbar-macro">
+    <div class="prev">
+        <a shape="rect" href="release-notes-535.html" rel="prev">
+                                    <span class="aui-icon aui-icon-small 
atb-icon-arrow-left">Previous</span>
+                                <span class="title">Release Notes 5.3.5</span>
+            </a>
+
+    </div>
+    <div class="parent">
+                    <a shape="rect" href="release-notes.html" rel="parent">
+                                            <span class="aui-icon 
aui-icon-small atb-icon-arrow-up">Up</span>
+                                        <span class="title">Release 
Notes</span>
+                </a>
+
+            </div>
+    <div class="next">
+        <a shape="rect" href="release-notes-537.html" rel="next">
+                <span class="title">Release Notes 5.3.7</span>
+                                    <span class="aui-icon aui-icon-small 
atb-icon-arrow-right">Next</span>
+                            </a>
+
+    </div>
+</div> 
 
 <p>This is the consolidated list of changes between Tapestry versions 5.3.5 
and 5.3.6. Tapestry 5.3.6 is a drop-in replacement for prior Tapestry 5.3 
releases. To upgrade, just update the Maven dependency in your POM file (or <a 
shape="rect" href="download.html">download</a> the new JAR file) and the new 
version will just work. However, please review the <a shape="rect" 
href="how-to-upgrade.html">How to Upgrade</a> instructions before upgrading. 
</p>
 
@@ -96,7 +119,31 @@
 <ul><li>[<a shape="rect" 
href="https://issues.apache.org/jira/browse/TAP5-1996";>TAP5-1996</a>] -         
Add Severity.SUCCESS enum for alerts
 </li></ul>
                                                 
- <p></p></div>
+ <p></p>
+    
+<div class="atb-scrollbar-macro">
+    <div class="prev">
+        <a shape="rect" href="release-notes-535.html" rel="prev">
+                                    <span class="aui-icon aui-icon-small 
atb-icon-arrow-left">Previous</span>
+                                <span class="title">Release Notes 5.3.5</span>
+            </a>
+
+    </div>
+    <div class="parent">
+                    <a shape="rect" href="release-notes.html" rel="parent">
+                                            <span class="aui-icon 
aui-icon-small atb-icon-arrow-up">Up</span>
+                                        <span class="title">Release 
Notes</span>
+                </a>
+
+            </div>
+    <div class="next">
+        <a shape="rect" href="release-notes-537.html" rel="next">
+                <span class="title">Release Notes 5.3.7</span>
+                                    <span class="aui-icon aui-icon-small 
atb-icon-arrow-right">Next</span>
+                            </a>
+
+    </div>
+</div></div>
 </div>
 
 <div class="clearer"></div>

Modified: websites/production/tapestry/content/release-notes-537.html
==============================================================================
--- websites/production/tapestry/content/release-notes-537.html (original)
+++ websites/production/tapestry/content/release-notes-537.html Sun Nov  8 
17:21:51 2015
@@ -67,7 +67,30 @@
   </div>
 
 <div id="content">
-<div id="ConfluenceContent">
+<div id="ConfluenceContent">    
+<div class="atb-scrollbar-macro">
+    <div class="prev">
+        <a shape="rect" href="release-notes-536.html" rel="prev">
+                                    <span class="aui-icon aui-icon-small 
atb-icon-arrow-left">Previous</span>
+                                <span class="title">Release Notes 5.3.6</span>
+            </a>
+
+    </div>
+    <div class="parent">
+                    <a shape="rect" href="release-notes.html" rel="parent">
+                                            <span class="aui-icon 
aui-icon-small atb-icon-arrow-up">Up</span>
+                                        <span class="title">Release 
Notes</span>
+                </a>
+
+            </div>
+    <div class="next">
+        <a shape="rect" href="release-notes-54.html" rel="next">
+                <span class="title">Release Notes 5.4</span>
+                                    <span class="aui-icon aui-icon-small 
atb-icon-arrow-right">Next</span>
+                            </a>
+
+    </div>
+</div>
 
 <p>This is the consolidated list of changes between Tapestry versions 5.3.6 
and 5.3.7. Tapestry 5.3.7 is a drop-in replacement for prior Tapestry 5.3 
releases. To upgrade, just update the Maven dependency in your POM file (or <a 
shape="rect" href="download.html">download</a> the new JAR file) and the new 
version will just work. However, please review the <a shape="rect" 
href="how-to-upgrade.html">How to Upgrade</a> instructions before upgrading.</p>
 
@@ -109,7 +132,31 @@
 <ul><li>[<a shape="rect" 
href="https://issues.apache.org/jira/browse/TAP5-2055";>TAP5-2055</a>] -         
Polish translations
 </li></ul>
 
-<p></p></div>
+<p></p>
+    
+<div class="atb-scrollbar-macro">
+    <div class="prev">
+        <a shape="rect" href="release-notes-536.html" rel="prev">
+                                    <span class="aui-icon aui-icon-small 
atb-icon-arrow-left">Previous</span>
+                                <span class="title">Release Notes 5.3.6</span>
+            </a>
+
+    </div>
+    <div class="parent">
+                    <a shape="rect" href="release-notes.html" rel="parent">
+                                            <span class="aui-icon 
aui-icon-small atb-icon-arrow-up">Up</span>
+                                        <span class="title">Release 
Notes</span>
+                </a>
+
+            </div>
+    <div class="next">
+        <a shape="rect" href="release-notes-54.html" rel="next">
+                <span class="title">Release Notes 5.4</span>
+                                    <span class="aui-icon aui-icon-small 
atb-icon-arrow-right">Next</span>
+                            </a>
+
+    </div>
+</div></div>
 </div>
 
 <div class="clearer"></div>

Modified: websites/production/tapestry/content/release-notes-54.html
==============================================================================
--- websites/production/tapestry/content/release-notes-54.html (original)
+++ websites/production/tapestry/content/release-notes-54.html Sun Nov  8 
17:21:51 2015
@@ -67,7 +67,30 @@
   </div>
 
 <div id="content">
-<div id="ConfluenceContent"> 
+<div id="ConfluenceContent">    
+<div class="atb-scrollbar-macro">
+    <div class="prev">
+        <a shape="rect" href="release-notes-537.html" rel="prev">
+                                    <span class="aui-icon aui-icon-small 
atb-icon-arrow-left">Previous</span>
+                                <span class="title">Release Notes 5.3.7</span>
+            </a>
+
+    </div>
+    <div class="parent">
+                    <a shape="rect" href="release-notes.html" rel="parent">
+                                            <span class="aui-icon 
aui-icon-small atb-icon-arrow-up">Up</span>
+                                        <span class="title">Release 
Notes</span>
+                </a>
+
+            </div>
+    <div class="next">
+        <a shape="rect" href="release-notes-538.html" rel="next">
+                <span class="title">Release notes 5.3.8</span>
+                                    <span class="aui-icon aui-icon-small 
atb-icon-arrow-right">Next</span>
+                            </a>
+
+    </div>
+</div> 
 
 <p>This is the consolidated list of changes between Tapestry versions 5.3 and 
5.4. To upgrade to 5.4, most users who are not using deprecated features will 
be able to just update the dependency version in their Maven POM file or Gradle 
build script (or <a shape="rect" href="download.html">download</a> the new JAR 
files) and the new version will just work. However, please read carefully below 
before upgrading, and also review the <a shape="rect" 
href="how-to-upgrade.html">How to Upgrade</a> instructions.</p>
 
@@ -108,7 +131,31 @@
 <p>Prior releases of Tapestry primarily organized client-side logic in terms 
of JavaScript libraries. These libraries can be declaratively imported into the 
page (either during a full-page render, or during an Ajax partial page update). 
In addition, libraries can be combined together into <em>stacks</em>, which (in 
a production application) are combined into a single virtual asset.</p>
 
 <p>The library approach is <a shape="rect" 
href="javascript-rewrite-in-54.html">fundamentally limited in a number of 
ways</a>, including namespace pollution and dealing with dependencies between 
libraries.  Tapestry 5.4 introduces a parallel mechanism, based on <a 
shape="rect" class="external-link" href="http://requirejs.org"; >RequireJS</a> 
and the <a shape="rect" class="external-link" 
href="https://github.com/amdjs/amdjs-api/wiki/AMD"; >Asynchronous Module 
Definition</a> as a way to speed up initial page load and organize client-side 
JavaScript in a more expressive and maintainable way.</p>
-</div>
+
+    
+<div class="atb-scrollbar-macro">
+    <div class="prev">
+        <a shape="rect" href="release-notes-537.html" rel="prev">
+                                    <span class="aui-icon aui-icon-small 
atb-icon-arrow-left">Previous</span>
+                                <span class="title">Release Notes 5.3.7</span>
+            </a>
+
+    </div>
+    <div class="parent">
+                    <a shape="rect" href="release-notes.html" rel="parent">
+                                            <span class="aui-icon 
aui-icon-small atb-icon-arrow-up">Up</span>
+                                        <span class="title">Release 
Notes</span>
+                </a>
+
+            </div>
+    <div class="next">
+        <a shape="rect" href="release-notes-538.html" rel="next">
+                <span class="title">Release notes 5.3.8</span>
+                                    <span class="aui-icon aui-icon-small 
atb-icon-arrow-right">Next</span>
+                            </a>
+
+    </div>
+</div></div>
 </div>
 
 <div class="clearer"></div>

Modified: websites/production/tapestry/content/release-upgrade-faq.html
==============================================================================
--- websites/production/tapestry/content/release-upgrade-faq.html (original)
+++ websites/production/tapestry/content/release-upgrade-faq.html Sun Nov  8 
17:21:51 2015
@@ -67,7 +67,26 @@
   </div>
 
 <div id="content">
-<div id="ConfluenceContent"> 
+<div id="ConfluenceContent">    
+<div class="atb-scrollbar-macro">
+    <div class="prev">
+        <a shape="rect" href="maven-support-faq.html" rel="prev">
+                                    <span class="aui-icon aui-icon-small 
atb-icon-arrow-left">Previous</span>
+                                <span class="title">Maven Support FAQ</span>
+            </a>
+
+    </div>
+    <div class="parent">
+                    <a shape="rect" href="frequently-asked-questions.html" 
rel="parent">
+                                            <span class="aui-icon 
aui-icon-small atb-icon-arrow-up">Up</span>
+                                        <span class="title">Frequently Asked 
Questions</span>
+                </a>
+
+            </div>
+    <div class="next">
+        
+    </div>
+</div> 
 
 <h2 id="ReleaseUpgradeFAQ-ReleaseUpgradeFAQ">Release Upgrade FAQ </h2>
 
@@ -76,7 +95,27 @@
 <h3 
id="ReleaseUpgradeFAQ-WhydoIgetanexceptionaboutorg.apache.tapestry5.internal.services.RequestPathOptimizerafterupgradingto5.2?">Why
 do I get an exception about 
org.apache.tapestry5.internal.services.RequestPathOptimizer after upgrading to 
5.2?</h3>
 
 <p>Although Tapestry works very hard to keep backwards compatibility between 
releases for <em>public</em> APIs, all <em>internal</em> APIs are subject to 
change. This error is commonly due to the use of the ChenilleKit library, which 
makes use of some internal APIs. You must also upgrade your ChenilleKit 
dependency when moving from Tapestry 5.1 to 5.2 or later. See the <a 
shape="rect" class="external-link" 
href="http://tapestry.markmail.org/thread/3cj2wuvl4idnpmjr"; >complete 
discussion of this from the Tapestry user mailing list</a>. </p>
-</div>
+
+    
+<div class="atb-scrollbar-macro">
+    <div class="prev">
+        <a shape="rect" href="maven-support-faq.html" rel="prev">
+                                    <span class="aui-icon aui-icon-small 
atb-icon-arrow-left">Previous</span>
+                                <span class="title">Maven Support FAQ</span>
+            </a>
+
+    </div>
+    <div class="parent">
+                    <a shape="rect" href="frequently-asked-questions.html" 
rel="parent">
+                                            <span class="aui-icon 
aui-icon-small atb-icon-arrow-up">Up</span>
+                                        <span class="title">Frequently Asked 
Questions</span>
+                </a>
+
+            </div>
+    <div class="next">
+        
+    </div>
+</div></div>
 </div>
 
 <div class="clearer"></div>

Modified: websites/production/tapestry/content/request-processing-faq.html
==============================================================================
--- websites/production/tapestry/content/request-processing-faq.html (original)
+++ websites/production/tapestry/content/request-processing-faq.html Sun Nov  8 
17:21:51 2015
@@ -67,7 +67,30 @@
   </div>
 
 <div id="content">
-<div id="ConfluenceContent"> 
+<div id="ConfluenceContent">    
+<div class="atb-scrollbar-macro">
+    <div class="prev">
+        <a shape="rect" href="integration-with-existing-applications.html" 
rel="prev">
+                                    <span class="aui-icon aui-icon-small 
atb-icon-arrow-left">Previous</span>
+                                <span class="title">Integration with existing 
applications</span>
+            </a>
+
+    </div>
+    <div class="parent">
+                    <a shape="rect" href="frequently-asked-questions.html" 
rel="parent">
+                                            <span class="aui-icon 
aui-icon-small atb-icon-arrow-up">Up</span>
+                                        <span class="title">Frequently Asked 
Questions</span>
+                </a>
+
+            </div>
+    <div class="next">
+        <a shape="rect" href="limitations.html" rel="next">
+                <span class="title">Limitations</span>
+                                    <span class="aui-icon aui-icon-small 
atb-icon-arrow-right">Next</span>
+                            </a>
+
+    </div>
+</div> 
 
 <h2 id="RequestProcessingFAQ-RequestProcessing">Request Processing</h2>
 
@@ -90,7 +113,30 @@ public static void contributeIgnoredPath
 
 <p>Alternately, you can configure the Tapestry application to execute inside a 
folder to avoid conflicts. See the notes on the <a shape="rect" 
href="configuration.html">configuration page</a>.</p>
 
- </div>
+    
+<div class="atb-scrollbar-macro">
+    <div class="prev">
+        <a shape="rect" href="integration-with-existing-applications.html" 
rel="prev">
+                                    <span class="aui-icon aui-icon-small 
atb-icon-arrow-left">Previous</span>
+                                <span class="title">Integration with existing 
applications</span>
+            </a>
+
+    </div>
+    <div class="parent">
+                    <a shape="rect" href="frequently-asked-questions.html" 
rel="parent">
+                                            <span class="aui-icon 
aui-icon-small atb-icon-arrow-up">Up</span>
+                                        <span class="title">Frequently Asked 
Questions</span>
+                </a>
+
+            </div>
+    <div class="next">
+        <a shape="rect" href="limitations.html" rel="next">
+                <span class="title">Limitations</span>
+                                    <span class="aui-icon aui-icon-small 
atb-icon-arrow-right">Next</span>
+                            </a>
+
+    </div>
+</div> </div>
 </div>
 
 <div class="clearer"></div>

Modified: websites/production/tapestry/content/security-faq.html
==============================================================================
--- websites/production/tapestry/content/security-faq.html (original)
+++ websites/production/tapestry/content/security-faq.html Sun Nov  8 17:21:51 
2015
@@ -67,7 +67,30 @@
   </div>
 
 <div id="content">
-<div id="ConfluenceContent"><h2 id="SecurityFAQ-SecurityFAQ">Security 
FAQ</h2><p>&#160;</p><div class="aui-label" style="float:right" title="Related 
Articles">
+<div id="ConfluenceContent"><p>    
+</p><div class="atb-scrollbar-macro">
+    <div class="prev">
+        <a shape="rect" href="tapestry-inversion-of-control-faq.html" 
rel="prev">
+                                    <span class="aui-icon aui-icon-small 
atb-icon-arrow-left">Previous</span>
+                                <span class="title">Tapestry Inversion of 
Control FAQ</span>
+            </a>
+
+    </div>
+    <div class="parent">
+                    <a shape="rect" href="frequently-asked-questions.html" 
rel="parent">
+                                            <span class="aui-icon 
aui-icon-small atb-icon-arrow-up">Up</span>
+                                        <span class="title">Frequently Asked 
Questions</span>
+                </a>
+
+            </div>
+    <div class="next">
+        <a shape="rect" href="integration-with-existing-applications.html" 
rel="next">
+                <span class="title">Integration with existing 
applications</span>
+                                    <span class="aui-icon aui-icon-small 
atb-icon-arrow-right">Next</span>
+                            </a>
+
+    </div>
+</div><h2 id="SecurityFAQ-SecurityFAQ">Security FAQ</h2><p>&#160;</p><div 
class="aui-label" style="float:right" title="Related Articles">
 
 
 
@@ -113,7 +136,30 @@
     if (productionMode) { configuration.override("LocalhostOnly", null); }
   } 
 </pre>
-</div></div><p></p></div>
+</div></div><p>    
+</p><div class="atb-scrollbar-macro">
+    <div class="prev">
+        <a shape="rect" href="tapestry-inversion-of-control-faq.html" 
rel="prev">
+                                    <span class="aui-icon aui-icon-small 
atb-icon-arrow-left">Previous</span>
+                                <span class="title">Tapestry Inversion of 
Control FAQ</span>
+            </a>
+
+    </div>
+    <div class="parent">
+                    <a shape="rect" href="frequently-asked-questions.html" 
rel="parent">
+                                            <span class="aui-icon 
aui-icon-small atb-icon-arrow-up">Up</span>
+                                        <span class="title">Frequently Asked 
Questions</span>
+                </a>
+
+            </div>
+    <div class="next">
+        <a shape="rect" href="integration-with-existing-applications.html" 
rel="next">
+                <span class="title">Integration with existing 
applications</span>
+                                    <span class="aui-icon aui-icon-small 
atb-icon-arrow-right">Next</span>
+                            </a>
+
+    </div>
+</div></div>
 </div>
 
 <div class="clearer"></div>

Modified: websites/production/tapestry/content/session-storage.html
==============================================================================
--- websites/production/tapestry/content/session-storage.html (original)
+++ websites/production/tapestry/content/session-storage.html Sun Nov  8 
17:21:51 2015
@@ -109,11 +109,11 @@
 </div><p>Ordinary <a shape="rect" 
href="persistent-page-data.html">page-persistent fields</a> won't work for 
this, since persistent fields are available only to a specific page, not shared 
across multiple pages.</p><p>Tapestry provides two mechanisms for storing such 
data: Session State Objects and Session Attributes. When deciding between the 
two, it's best to use Session State Objects for complex objects, and Session 
Attributes for simple types.</p><h2 
id="SessionStorage-SessionStateObjects">Session State Objects</h2><p>With a 
Session State Object (SSO), the value is automatically stored outside the page; 
with the default storage strategy, it is stored in the session. Such a value is 
global to all pages <em>for the same user</em>, but is stored separately for 
different users.</p><p>A field holding an SSO is marked with the @<a 
shape="rect" class="external-link" 
href="http://tapestry.apache.org/current/apidocs/org/apache/tapestry5/annotations/SessionState.html";>SessionState</a>
 ann
 otation.</p><div class="navmenu" style="float:right; background:white; 
margin:3px; padding:3px">
 <div class="panel" style="border-width: 1px;"><div class="panelHeader" 
style="border-bottom-width: 1px;"><b>Contents</b></div><div 
class="panelContent">
 <style type="text/css">/*<![CDATA[*/
-div.rbtoc1437945582068 {padding: 0px;}
-div.rbtoc1437945582068 ul {list-style: disc;margin-left: 0px;}
-div.rbtoc1437945582068 li {margin-left: 0px;padding-left: 0px;}
+div.rbtoc1447003269495 {padding: 0px;}
+div.rbtoc1447003269495 ul {list-style: disc;margin-left: 0px;}
+div.rbtoc1447003269495 li {margin-left: 0px;padding-left: 0px;}
 
-/*]]>*/</style><div class="toc-macro rbtoc1437945582068">
+/*]]>*/</style><div class="toc-macro rbtoc1447003269495">
 <ul class="toc-indentation"><li>Related Articles</li></ul>
 <ul><li><a shape="rect" href="#SessionStorage-SessionStateObjects">Session 
State Objects</a>
 <ul class="toc-indentation"><li><a shape="rect" 
href="#SessionStorage-Pitfalls">Pitfalls</a></li><li><a shape="rect" 
href="#SessionStorage-CheckforCreation">Check for Creation</a></li><li><a 
shape="rect" href="#SessionStorage-PersistenceStrategies">Persistence 
Strategies</a></li><li><a shape="rect" 
href="#SessionStorage-ConfiguringSSOs">Configuring SSOs</a></li></ul>

Modified: websites/production/tapestry/content/specific-errors-faq.html
==============================================================================
--- websites/production/tapestry/content/specific-errors-faq.html (original)
+++ websites/production/tapestry/content/specific-errors-faq.html Sun Nov  8 
17:21:51 2015
@@ -67,7 +67,30 @@
   </div>
 
 <div id="content">
-<div id="ConfluenceContent"><div class="aui-label" style="float:right" 
title="Related Articles">
+<div id="ConfluenceContent"><p>    
+</p><div class="atb-scrollbar-macro">
+    <div class="prev">
+        <a shape="rect" href="limitations.html" rel="prev">
+                                    <span class="aui-icon aui-icon-small 
atb-icon-arrow-left">Previous</span>
+                                <span class="title">Limitations</span>
+            </a>
+
+    </div>
+    <div class="parent">
+                    <a shape="rect" href="frequently-asked-questions.html" 
rel="parent">
+                                            <span class="aui-icon 
aui-icon-small atb-icon-arrow-up">Up</span>
+                                        <span class="title">Frequently Asked 
Questions</span>
+                </a>
+
+            </div>
+    <div class="next">
+        <a shape="rect" href="hibernate-support-faq.html" rel="next">
+                <span class="title">Hibernate Support FAQ</span>
+                                    <span class="aui-icon aui-icon-small 
atb-icon-arrow-right">Next</span>
+                            </a>
+
+    </div>
+</div><div class="aui-label" style="float:right" title="Related Articles">
 
 
 
@@ -106,7 +129,30 @@
                         
                     </div>
     </li></ul>
-</div><h3 
id="SpecificErrorsFAQ-WhydoIgettheexception&quot;Noserviceimplementstheinterfaceorg.apache.tapestry5.internal.InternalComponentResources&quot;whentryingtousetheBeanEditFormcomponent?">Why
 do I get the exception "No service implements the interface 
org.apache.tapestry5.internal.InternalComponentResources" when trying to use 
the BeanEditForm component?</h3><p>This can occur when you choose the wrong 
package for your data object, the object edited by the BeanEditForm component. 
If you place it in the same package as your pages, Tapestry will treat it like 
a page, and perform a number of transformation on it, including adding a new 
constructor.</p><p>Only component classes should go in the Tapestry-controlled 
packages (<code>pages</code>, <code>components</code>, <code>mixins</code> and 
<code>base</code> under your application's root package). By convention, simple 
data objects should go in a <code>data</code> package, and Hibernate entities 
should go in an <code>entities</cod
 e> package.</p><div class="confluence-information-macro 
confluence-information-macro-note"><span class="aui-icon aui-icon-small 
aui-iconfont-warning confluence-information-macro-icon"></span><div 
class="confluence-information-macro-body"><p>This is likely a bit different in 
5.3 than in 5.2 (because 5.3 builds a very different constructor into the 
component) and needs to be tested in 5.3 to see what exact exception will 
occur.</p></div></div><h3 
id="SpecificErrorsFAQ-Igetanerrorabout&quot;Pagedidnotgenerateanymarkupwhenrendered.&quot;butIhaveatemplate,whathappened?">I
 get an error about "Page did not generate any markup when rendered." but I 
have a template, what happened?</h3><p>The most common error here is that the 
case of the page class did not match the case of the template. For example, you 
might name your class ViewOrders, but name the template vieworders.tml. The 
correct name for the template is ViewOrders.tml, matching the case of the Java 
class name.</p><p>Worse, you may fi
 nd that your application works during development (under Windows, which is 
case insensitive) but does not work when deployed on a Linux or Unix server, 
which may be case sensitive.</p><p>The other cause of this may be that your 
template files simply are not being packaged up correctly with the rest of your 
application. When in doubt, use the Java <code>jar</code> command to see 
exactly whats inside your WAR file. Your page templates should either be in the 
root folder of the WAR, or package with the corresponding .class file.</p><h3 
id="SpecificErrorsFAQ-MyapplicationfailswiththeerrorPermGen,howdoIfixthis?">My 
application fails with the error <strong>PermGen</strong>, how do I fix 
this?</h3><p>PermGen refers to the part of the Java memory space devoted to 
permanent objects, which are mostly loaded classes. When developing under 
Tapestry, many more classes and class loaders are created than normal; this is 
part of live class reloading. Because of this, you will want to increase the a
 mount of memory Java devotes to this.</p><p>The solution is to add 
<code>-XX:MaxPermSize=512m</code> to your command line. You may also want to 
increase the regular amount of heap space with <code>-Xmx600M</code>. Of 
course, you may need to adjust the amount of memory in each category to match 
your actual application, but these are good starting values.</p><p>Java Virtual 
Machine arguments can be specified inside an Eclipse launch 
configuration:</p><p><span class="confluence-embedded-file-wrapper"><img 
class="confluence-embedded-image confluence-thumbnail" 
src="specific-errors-faq.data/eclipse-permgen.png"></span></p><h3 
id="SpecificErrorsFAQ-WhydoIsometimesgetajava.lang.NoSuchMethodErrorexceptionafterreloadingmypage?">Why
 do I sometimes get a <code>java.lang.NoSuchMethodError</code> exception after 
reloading my page?</h3><p>Tapestry's live class reloading is not 
perfect.&#160;<span style="line-height: 1.4285715;">It tends to use a lot of 
Java ClassLoaders on top of the normal Class
 Loaders used by the Java Virtual Machine and the servlet container. When you 
change non-component classes and interfaces that are referenced by components 
and pages, such as to add or change a method, only the component classes are 
reloaded. The non-component classes are frozen as they were when they were 
</span><em style="line-height: 1.4285715;">first</em><span style="line-height: 
1.4285715;"> loaded.</span></p><p>Unfortunately, this is one of the areas where 
you must restart your application entirely in order to force the new versions 
of the non-component classes to be loaded into memory.</p><p>&#160;</p></div>
+</div><h3 
id="SpecificErrorsFAQ-WhydoIgettheexception&quot;Noserviceimplementstheinterfaceorg.apache.tapestry5.internal.InternalComponentResources&quot;whentryingtousetheBeanEditFormcomponent?">Why
 do I get the exception "No service implements the interface 
org.apache.tapestry5.internal.InternalComponentResources" when trying to use 
the BeanEditForm component?</h3><p>This can occur when you choose the wrong 
package for your data object, the object edited by the BeanEditForm component. 
If you place it in the same package as your pages, Tapestry will treat it like 
a page, and perform a number of transformation on it, including adding a new 
constructor.</p><p>Only component classes should go in the Tapestry-controlled 
packages (<code>pages</code>, <code>components</code>, <code>mixins</code> and 
<code>base</code> under your application's root package). By convention, simple 
data objects should go in a <code>data</code> package, and Hibernate entities 
should go in an <code>entities</cod
 e> package.</p><div class="confluence-information-macro 
confluence-information-macro-note"><span class="aui-icon aui-icon-small 
aui-iconfont-warning confluence-information-macro-icon"></span><div 
class="confluence-information-macro-body"><p>This is likely a bit different in 
5.3 than in 5.2 (because 5.3 builds a very different constructor into the 
component) and needs to be tested in 5.3 to see what exact exception will 
occur.</p></div></div><h3 
id="SpecificErrorsFAQ-Igetanerrorabout&quot;Pagedidnotgenerateanymarkupwhenrendered.&quot;butIhaveatemplate,whathappened?">I
 get an error about "Page did not generate any markup when rendered." but I 
have a template, what happened?</h3><p>The most common error here is that the 
case of the page class did not match the case of the template. For example, you 
might name your class ViewOrders, but name the template vieworders.tml. The 
correct name for the template is ViewOrders.tml, matching the case of the Java 
class name.</p><p>Worse, you may fi
 nd that your application works during development (under Windows, which is 
case insensitive) but does not work when deployed on a Linux or Unix server, 
which may be case sensitive.</p><p>The other cause of this may be that your 
template files simply are not being packaged up correctly with the rest of your 
application. When in doubt, use the Java <code>jar</code> command to see 
exactly whats inside your WAR file. Your page templates should either be in the 
root folder of the WAR, or package with the corresponding .class file.</p><h3 
id="SpecificErrorsFAQ-MyapplicationfailswiththeerrorPermGen,howdoIfixthis?">My 
application fails with the error <strong>PermGen</strong>, how do I fix 
this?</h3><p>PermGen refers to the part of the Java memory space devoted to 
permanent objects, which are mostly loaded classes. When developing under 
Tapestry, many more classes and class loaders are created than normal; this is 
part of live class reloading. Because of this, you will want to increase the a
 mount of memory Java devotes to this.</p><p>The solution is to add 
<code>-XX:MaxPermSize=512m</code> to your command line. You may also want to 
increase the regular amount of heap space with <code>-Xmx600M</code>. Of 
course, you may need to adjust the amount of memory in each category to match 
your actual application, but these are good starting values.</p><p>Java Virtual 
Machine arguments can be specified inside an Eclipse launch 
configuration:</p><p><span class="confluence-embedded-file-wrapper"><img 
class="confluence-embedded-image confluence-thumbnail" 
src="specific-errors-faq.data/eclipse-permgen.png"></span></p><h3 
id="SpecificErrorsFAQ-WhydoIsometimesgetajava.lang.NoSuchMethodErrorexceptionafterreloadingmypage?">Why
 do I sometimes get a <code>java.lang.NoSuchMethodError</code> exception after 
reloading my page?</h3><p>Tapestry's live class reloading is not 
perfect.&#160;<span style="line-height: 1.4285715;">It tends to use a lot of 
Java ClassLoaders on top of the normal Class
 Loaders used by the Java Virtual Machine and the servlet container. When you 
change non-component classes and interfaces that are referenced by components 
and pages, such as to add or change a method, only the component classes are 
reloaded. The non-component classes are frozen as they were when they were 
</span><em style="line-height: 1.4285715;">first</em><span style="line-height: 
1.4285715;"> loaded.</span></p><p>Unfortunately, this is one of the areas where 
you must restart your application entirely in order to force the new versions 
of the non-component classes to be loaded into memory.</p><p>&#160;    
+</p><div class="atb-scrollbar-macro">
+    <div class="prev">
+        <a shape="rect" href="limitations.html" rel="prev">
+                                    <span class="aui-icon aui-icon-small 
atb-icon-arrow-left">Previous</span>
+                                <span class="title">Limitations</span>
+            </a>
+
+    </div>
+    <div class="parent">
+                    <a shape="rect" href="frequently-asked-questions.html" 
rel="parent">
+                                            <span class="aui-icon 
aui-icon-small atb-icon-arrow-up">Up</span>
+                                        <span class="title">Frequently Asked 
Questions</span>
+                </a>
+
+            </div>
+    <div class="next">
+        <a shape="rect" href="hibernate-support-faq.html" rel="next">
+                <span class="title">Hibernate Support FAQ</span>
+                                    <span class="aui-icon aui-icon-small 
atb-icon-arrow-right">Next</span>
+                            </a>
+
+    </div>
+</div></div>
 </div>
 
 <div class="clearer"></div>

Modified: 
websites/production/tapestry/content/supporting-informal-parameters.html
==============================================================================
--- websites/production/tapestry/content/supporting-informal-parameters.html 
(original)
+++ websites/production/tapestry/content/supporting-informal-parameters.html 
Sun Nov  8 17:21:51 2015
@@ -67,7 +67,30 @@
   </div>
 
 <div id="content">
-<div id="ConfluenceContent"><p><strong>Informal parameters</strong> are any 
additional parameters beyond the parameters explicitly defined for a component 
using the <a shape="rect" class="external-link" 
href="http://tapestry.apache.org/tapestry5/apidocs/org/apache/tapestry5/annotations/Parameter.html";>Parameter</a>
 annotation.</p><div class="aui-label" style="float:right" title="Related 
Articles">
+<div id="ConfluenceContent"><p>    
+</p><div class="atb-scrollbar-macro">
+    <div class="prev">
+        <a shape="rect" href="error-page-recipe.html" rel="prev">
+                                    <span class="aui-icon aui-icon-small 
atb-icon-arrow-left">Previous</span>
+                                <span class="title">Error Page Recipe</span>
+            </a>
+
+    </div>
+    <div class="parent">
+                    <a shape="rect" href="cookbook.html" rel="parent">
+                                            <span class="aui-icon 
aui-icon-small atb-icon-arrow-up">Up</span>
+                                        <span class="title">Cookbook</span>
+                </a>
+
+            </div>
+    <div class="next">
+        <a shape="rect" href="component-libraries.html" rel="next">
+                <span class="title">Component Libraries</span>
+                                    <span class="aui-icon aui-icon-small 
atb-icon-arrow-right">Next</span>
+                            </a>
+
+    </div>
+</div><strong>Informal parameters</strong> are any additional parameters 
beyond the parameters explicitly defined for a component using the <a 
shape="rect" class="external-link" 
href="http://tapestry.apache.org/tapestry5/apidocs/org/apache/tapestry5/annotations/Parameter.html";>Parameter</a>
 annotation.<div class="aui-label" style="float:right" title="Related Articles">
 
 
 



Reply via email to