Hi All, I have a problem with a DataError at /admin/polls/poll/5/ (1406, "Data too long for column 'choice' at row 1"), even though the model field is set as a textfield which is taking longtext.
The data I'm trying to input is this below, as you can see it's not very long at all. I've tried setting the max_length to 10000 even though I not sure whether that is a valid argument or not. There appears to be a similar previous post which was fixed but only for non-windows users. I'm using windows. Hope this makes sense. I am a newbie at this so this is probably a trivial matter for you all. ---------------------- input data: >gi|3819788|emb|CAA09968.1| immunoglobulin heavy chain, constant region, >alpha-2 subunit [Homo sapiens] VPPPPPCCHPRLSLHRPALEDLLLGSEANLTCTLTGLRDAS GATFTWTPSSGKSAVQGPPERDLCGCYSVSSVLPGCAQPWNHGETFTCTAAHPELKTPLTANITKSGNTF RPEVHLLPPPSEELALNELVTLTCLARGFSPKDVLVRWLQGSQELPREKYLTWASRQEPSQGTTTFAVTS ILRVAAEDWKKGDTFSCMVGHEALPLAFTQKTIDRLAGKPTHVNVSVVMAEVDGTCY Many thanks, Emily --~--~---------~--~----~------------~-------~--~----~ You received this message because you are subscribed to the Google Groups "Django users" group. To post to this group, send email to [email protected] To unsubscribe from this group, send email to [EMAIL PROTECTED] For more options, visit this group at http://groups.google.com/group/django-users?hl=en -~----------~----~----~----~------~----~------~--~---

