Hello, I used "digest" from EMBOSS to digest protein database obtained from NCBI REFSEQ. Here is how I executed digest: digest -seqall "DB_NAME" -aadata "File_name"- outfile "File_Name" From the list I selected trypsin For some reason, digest skipped (no fragments were generated) for this particular protein >gi|118430285|ref|YP_874719.1| photosystem II protein K [Agrostis stolonifera] MPNILSLTCICFNSVLYPTTSFFFAKLPEAYAIFNPIVDVMPVIPLFFFLLAFVWQAAVSFR
any ideas? I should get two fragments. I don't want to see the partial digests so that is why I never selected the option. Thanks Sudeep _______________________________________________ EMBOSS mailing list [email protected] http://lists.open-bio.org/mailman/listinfo/emboss
