On Mon, Jan 11, 2010 at 2:26 PM, Fungazid <[email protected]> wrote: > > Hello people, > > I just installed emboss on linux ubuntu (using the ubuntu synaptic package > manager). I am using the getorf program, and I see it gives me this kind of > output lines: > >>00001_3 [803 - 1120] > LARLRFVVLGNSFIASAKGWSTPYGPTTFGPFRSCIYPRVFRSTRVRKAMATRIGSNRVN > ILIRCTXXXXXXXXXXXXXXXXXXXXXXXXXNPYLGWWCYIFCIFR > > I don't like the Xs as they represent unspecified amino acids. Is there an > input parameter to tell the program to report only the regions before and > after the Xs ? > > In addition (and maybe this is beyond the scope of this mailing list) what is > the biological meaning of such Xs ?
What was the input sequence like? Was there a stretch of NNNNN perhaps? Peter _______________________________________________ EMBOSS mailing list [email protected] http://lists.open-bio.org/mailman/listinfo/emboss
