On Mon, Jan 11, 2010 at 2:26 PM, Fungazid <[email protected]> wrote:
>
> Hello people,
>
> I just installed emboss on linux ubuntu (using the ubuntu synaptic package 
> manager). I am using the getorf program, and I see it gives me this kind of 
> output lines:
>
>>00001_3 [803 - 1120]
> LARLRFVVLGNSFIASAKGWSTPYGPTTFGPFRSCIYPRVFRSTRVRKAMATRIGSNRVN
> ILIRCTXXXXXXXXXXXXXXXXXXXXXXXXXNPYLGWWCYIFCIFR
>
> I don't like the Xs as they represent unspecified amino acids. Is there an 
> input parameter to tell the program to report only the regions before and 
> after the Xs ?
>
> In addition (and maybe this is beyond the scope of this mailing list) what is 
> the biological meaning of such Xs ?

What was the input sequence like? Was there a stretch of NNNNN perhaps?

Peter
_______________________________________________
EMBOSS mailing list
[email protected]
http://lists.open-bio.org/mailman/listinfo/emboss

Reply via email to