Hello Ahmad,

Do you have 500+ alignments, or an alignment with 500+ sequences?


Select | Find should highlight the next match of your search pattern in the 
alignment which has focus. You may have fallen foul of a bug whereby Find 
matched results in hidden regions. This is fixed in the next release of Jalview 
(2.11), due out any day now. If this wasn't your problem, please let us know 
more details if possible.


Moving a sequence to top: you are right, there is no direct way to do this in 
Jalview, and we could consider adding one. As a workaround you could:

1) Edit | Cut  and Edit | Paste the sequence to a new alignment window

2) Select all (remaining) sequences, Copy, and Paste in the new window

This would leave the target sequence at the top (and will be quicker than 
clicking 'Up' arrow a few hundred times!).


Best regards,


Mungo





[University of Dundee shield logo]<http://uod.ac.uk/sig-home>

Mungo Carstairs
Jalview Computational Scientist

The Barton Group
Division of Computational Biology

School of Life Sciences

University of Dundee, Dundee, Scotland, UK

www.jalview.org<http://www.jalview.org>

www.compbio.dundee.ac.uk<http://www.compbio.dundee.ac.uk>
g.m.carsta...@dundee.ac.uk<mailto:g.m.carsta...@dundee.ac.uk>

[University of Dundee Facebook]<http://uod.ac.uk/sig-fb> [University of Dundee 
Twitter] <http://uod.ac.uk/sig-tw>  [University of Dundee LinkedIn] 
<http://uod.ac.uk/sig-li>  [University of Dundee YouTube] 
<http://uod.ac.uk/sig-yt>  [University of Dundee Instagram] 
<http://uod.ac.uk/sig-ig>  [University of Dundee Snapchat] 
<http://uod.ac.uk/sig-sc>
We're Scottish University of the Year again!<http://uod.ac.uk/sig-strapline>
The Times / Sunday Times Good University Guide 2016 and 2017
________________________________
From: jalview-discuss-boun...@jalview.org <jalview-discuss-boun...@jalview.org> 
on behalf of Ahmad Khalifa <underoath...@gmail.com>
Sent: 27 May 2019 11:07:11
To: jalview-discuss@jalview.org
Subject: [Jalview-discuss] Finding alignment and moving it to the top of the 
list

I have 500+ alignments, I tried select find and searched for ID, some residue 
segments and couldn't find my sequence of interest! I had to scan the entire 
list by eye to find it, but then there is the problem of moving it to the top, 
is there any other way to do it besides clicking ctrl and up for 5 minutes?!

This is the sequence as it appears in the alignment file for reference:

>XP_001023006.1 tubulin [Tetrahymena thermophila SB210]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------MREIVHIQGGQCGNQIGAKFWEVISDEHGIDP-----TGTYHGDSDLQ
LERINVYYNEATGGRYVPRAILMDLEPGTMDSVRAGPFGQLFRPDNFVFGQTGAGNNWAK
GHYTEGAELIDSVLDVVRKEAEGCDCLQGFQITHSLGGGTGSGMGTLLISKVREEYPDRI
METFSVVPSPKVSDTVVEPYNATLSVHQLVENADECMVIDNEALYDICFRTLKLTTPT--
YGDLNHLVSAAMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMIGFAPLTSRGSQQY
RALTVPELTQQMFDAKNMMCAADPRHGRYLTASALFRGRMSTKEVDEQMLNVQNKNSSYF
VEWIPNNIKSSICDIPPKGLKMAVTFVGNSTAI--QEMFKRVAEQFTAMFRRKAFLHWYT
GEGMDEMEFTEAESNMNDLVSEYQQYQDATAEEEGEFEEEEGEN----------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------

Regards.

The University of Dundee is a registered Scottish Charity, No: SC015096
_______________________________________________
Jalview-discuss mailing list
Jalview-discuss@jalview.org
http://www.compbio.dundee.ac.uk/mailman/listinfo/jalview-discuss

Reply via email to