Jira (PDB-1485) Align url-prefix in foss to align with pe-puppetdb
Title: Message Title Kenneth Barber created an issue PuppetDB / PDB-1485 Align url-prefix in foss to align with pe-puppetdb Issue Type: Task Assignee: Unassigned Created: 2015/05/06 3:08 AM Fix Versions: PDB 3.0.0 Priority: Normal Reporter: Kenneth Barber We need to figure out what we want to do with the main url-prefix, right now pe-puppetdb uses /pdb for our API, and foss uses / ... this breaks the dashboard in PE by using this, I figure we should do one (or more) of the following: a) Make the dashboard follow the URL-prefix properly b) Change the default url-prefix to align for both shipped packages c) Consider using web-routing for these decisions in config for say FOSS, in favour of the old url-prefix potentially? This way there is one place to configure each service. Add Comment
Jira (PDB-1486) Rename /pe /sync endpoints to something more puppetdb specific
Title: Message Title Kenneth Barber created an issue PuppetDB / PDB-1486 Rename /pe /sync endpoints to something more puppetdb specific Issue Type: Task Assignee: Unassigned Created: 2015/05/06 3:13 AM Fix Versions: PDB 3.0.0 Priority: Normal Reporter: Kenneth Barber The /pe /sync endpoint could probably do with some uniqueness across applications in case we wish to later host other applications in the same JVM. Add Comment
Jira (PDB-1472) [Performance] Improvements for paged results
Title: Message Title Karel Brezina commented on PDB-1472 Re: [Performance] Improvements for paged results Thanks Wyatt Alt for taking your time. I'm glad that you found the strange behavior even on your machine. Add Comment This message was sent by Atlassian JIRA (v6.3.15#6346-sha1:dbc023d) -- You received this message because you are subscribed to the Google Groups Puppet Bugs group. To unsubscribe from this group and stop receiving emails from it, send an email to puppet-bugs+unsubscr...@googlegroups.com. To post to this group, send email to puppet-bugs@googlegroups.com. Visit this group at http://groups.google.com/group/puppet-bugs. For more options, visit https://groups.google.com/d/optout.
Jira (PDB-1484) Memory leak when 'replace facts' failing
Title: Message Title Simon Oxwell created an issue PuppetDB / PDB-1484 Memory leak when 'replace facts' failing Issue Type: Bug Affects Versions: PDB 2.3.3 Assignee: Unassigned Created: 2015/05/05 11:51 PM Environment: CentOS 7, Postgres 9.2.7 Priority: Normal Reporter: Simon Oxwell Hi, Just as an aside to PDB-1448 , we're also seeing PuppetDB run out of heap. Looking at the memory dumps, we see a very large number of Postgres Prepared Statements, taking up huge amounts of memory. For example, from today we had: 4,881 instances of org.postgresql.jdbc4.Jdbc4PreparedStatement with retained size of 500,866,312 bytes and one from a month ago: 4,614 instances of org.postgresql.jdbc4.Jdbc4PreparedStatement with retained size of 617,294,101 bytes. Our heap size is 750M, and 109 puppet agents. My guess is that when the 'replace facts' fails with the foreign key constraint violation, it doesn't clean up the prepared statement objects.
Jira (PUP-4530) FreeBSD specific Service provider fix
Title: Message Title Matthew Seaman created an issue Puppet / PUP-4530 FreeBSD specific Service provider fix Issue Type: Bug Affects Versions: PUP 3.7.5, PUP 3.6.2 Assignee: Unassigned Attachments: puppet-3.7.5.patch Components: Platform Created: 2015/05/06 4:38 AM Environment: FreeBSD sys-puppet-1.adestra.com 10.1-RELEASE-p5 FreeBSD 10.1-RELEASE-p5 #0: Tue Jan 27 08:55:07 UTC 2015 r...@amd64-builder.daemonology.net:/usr/obj/usr/src/sys/GENERIC amd64 Priority: Normal Reporter: Matthew Seaman The Service provider for FreeBSD parses the output of 'service foo rcvar' to work out what the service name is. However for some services – only a very few – the output contains an optional
Jira (PUP-4045) Failed to generate additional resources using 'eval_generate': Cannot manage files of type socket
Title: Message Title Peter Souter updated an issue Puppet / PUP-4045 Failed to generate additional resources using 'eval_generate': Cannot manage files of type socket Change By: Peter Souter UsingaslightlymodifiedversionofthecodefromProPuppetIamgettingthefollowingerror: {code} Jun1301:36:33mediapuppet-agent[18196]:(/Stage[main]/Mysql::Config/File[mysql_data_dir])Failedtogenerateadditionalresourcesusing'eval_generate':Cannotmanagefilesoftypesocket {code} Thefileresourceinmysql/manifests/config.ppisasfollows: {code} file{mysql_data_dir:path=$mysql::params::data_directory,group=mysql,owner=mysql,recurse=true,require=File[my.cnf],} {code} Andforthisparticular$operatingsystem(Fedora)thevaluefor$data_directoryinmysql/manifests/params.ppis: {code} $data_directory=/var/lib/mysql {code} BydefaultmysqlonaFedorasystemplacesitsmysql.sockfileinthedatadirectorybutitappearswhenayoutryandchangethepermissionsrecursively,puppetdoesn'tknowwhattodowiththesocketfile.IcanplacethesocketfileelsewhereasaworkaroundbutIbelievethatpuppetneedstoignoresocketfileswhenchangingpermissions. {code} [root@mediamodules]#puppet--version2.6.8[root@mediamodules]#puppetmaster--version2.6.8 {code} Add Comment This message was sent by Atlassian JIRA (v6.3.15#6346-sha1:dbc023d) -- You received this message because you are subscribed to the Google Groups Puppet Bugs group. To unsubscribe from this group and stop receiving emails from it, send an email to puppet-bugs+unsubscr...@googlegroups.com. To post to this group, send email to puppet-bugs@googlegroups.com. Visit this group at
Jira (PUP-4045) Failed to generate additional resources using 'eval_generate': Cannot manage files of type socket
Title: Message Title Peter Souter commented on PUP-4045 Re: Failed to generate additional resources using 'eval_generate': Cannot manage files of type socket As someone who encountered this recently, and needed to use the workaround of adding the socket files to the `ignore` parameter, you can find out what files are sockets with `tree` easy enough: $ tree --inodes -F | grep = │ │ ├── [2458821] S_TCP= So I needed to add this to my code: ignore= ['S_TCP'] Add Comment This message was sent by Atlassian JIRA (v6.3.15#6346-sha1:dbc023d)
Jira (PDB-949) Retrieving facts that have had 'trusted' facts injected into them causes a 400 Attempt to assign to a reserved variable name: 'trusted' on node failure during Puppet catalog compilati
Title: Message Title Kenneth Barber commented on PDB-949 Re: Retrieving facts that have had 'trusted' facts injected into them causes a 400 Attempt to assign to a reserved variable name: 'trusted' on node failure during Puppet catalog compilation. Charlie Sharpsteen I think perhaps you're missing the subtlety of this larger problem, or I'm not describing it very well. Ping me if you want when you're not busy, we can have a chat. Add Comment This message was sent by Atlassian JIRA (v6.3.15#6346-sha1:dbc023d) -- You received this message because you are subscribed to the Google Groups Puppet Bugs group. To unsubscribe from this group and stop receiving emails from it, send an email to puppet-bugs+unsubscr...@googlegroups.com. To post to this group, send email to puppet-bugs@googlegroups.com. Visit this group at http://groups.google.com/group/puppet-bugs. For more options, visit https://groups.google.com/d/optout.
Jira (PUP-4528) Chaining arrows do not work as expected with empty resources
Title: Message Title Henrik Lindberg commented on PUP-4528 Re: Chaining arrows do not work as expected with empty resources This is a known issue - IIRC there should be a warning when this happens and using the future parser. On the one hand it does exactly what is expected - the statement becomes depends on nothing, and nothing depends on. Not sure if we want to change that. It could be made an error, or it could short circuit (just skip the empty part). The later could lead to other hard to detect problems. An error is probably preferable as there is really no real practical use of an empty set in the middle of a chain (nor at the beginning or end of a chain). Add Comment This message was sent by Atlassian JIRA (v6.3.15#6346-sha1:dbc023d) -- You received this message because you are subscribed to the Google Groups Puppet Bugs group. To unsubscribe from this group and stop receiving emails from it, send an email to puppet-bugs+unsubscr...@googlegroups.com. To post to this group, send email to puppet-bugs@googlegroups.com. Visit this group at http://groups.google.com/group/puppet-bugs. For more options, visit https://groups.google.com/d/optout.
Jira (FACT-956) Update puppet-agent#master to build facter#master, remove cfacter
Title: Message Title Rob Reynolds commented on FACT-956 Re: Update puppet-agent#master to build facter#master, remove cfacter Puppet-Agent merged into master at 80ca92e Add Comment This message was sent by Atlassian JIRA (v6.3.15#6346-sha1:dbc023d) -- You received this message because you are subscribed to the Google Groups Puppet Bugs group. To unsubscribe from this group and stop receiving emails from it, send an email to puppet-bugs+unsubscr...@googlegroups.com. To post to this group, send email to puppet-bugs@googlegroups.com. Visit this group at http://groups.google.com/group/puppet-bugs. For more options, visit https://groups.google.com/d/optout.
Jira (PDB-1315) Add sync information to metrics
Title: Message Title Ryan Senior updated an issue PuppetDB / PDB-1315 Add sync information to metrics Change By: Ryan Senior Sprint: PuppetDB2015-05-20 Add Comment This message was sent by Atlassian JIRA (v6.3.15#6346-sha1:dbc023d) -- You received this message because you are subscribed to the Google Groups Puppet Bugs group. To unsubscribe from this group and stop receiving emails from it, send an email to puppet-bugs+unsubscr...@googlegroups.com. To post to this group, send email to puppet-bugs@googlegroups.com. Visit this group at http://groups.google.com/group/puppet-bugs. For more options, visit https://groups.google.com/d/optout.
Jira (PDB-1313) Clojure network/node failure tests for single datacenter HA topology
Title: Message Title Ryan Senior updated an issue PuppetDB / PDB-1313 Clojure network/node failure tests for single datacenter HA topology Change By: Ryan Senior Sprint: PuppetDB2015-05-20 Add Comment This message was sent by Atlassian JIRA (v6.3.15#6346-sha1:dbc023d) -- You received this message because you are subscribed to the Google Groups Puppet Bugs group. To unsubscribe from this group and stop receiving emails from it, send an email to puppet-bugs+unsubscr...@googlegroups.com. To post to this group, send email to puppet-bugs@googlegroups.com. Visit this group at http://groups.google.com/group/puppet-bugs. For more options, visit https://groups.google.com/d/optout.
Jira (PDB-949) Retrieving facts that have had 'trusted' facts injected into them causes a 400 Attempt to assign to a reserved variable name: 'trusted' on node failure during Puppet catalog compilati
Title: Message Title Kenneth Barber commented on PDB-949 Re: Retrieving facts that have had 'trusted' facts injected into them causes a 400 Attempt to assign to a reserved variable name: 'trusted' on node failure during Puppet catalog compilation. And to add more to this, by disabling trusted you're just masking the cache miss. If the master gets a cache miss, it will try to query PuppetDB for facts instead which is not desirable, so even if we fix this, we're then left with a gaping problem that users won't see until they are hours deep into an investigation. So while our use of trusted creates a confusing error message, its really surfacing a deeper issue, in that cache misses create unpredictable outcomes and do not warn the user properly. Just to be clear in case my previous points on this are vague, we have no set of actions on this today ... nor is a real next set of steps set out. Its been suggested to us to change this behaviour and to not use 'trusted' which is certainly possible, but still - there is a bigger bug behind it and I don't think thats necessarily the full correct answer (although its a cheap way to get rid of the error I suppose . I'd be happy to have a chat to people about this if we have the time, it feels like we need a cross-team solution rather than 'just fix it on the pdb side' ... perhaps I haven't been clear on making my point - happy to clarify via a chat if required. Add Comment This message was sent by Atlassian JIRA (v6.3.15#6346-sha1:dbc023d) -- You received this message because you are subscribed to the Google Groups Puppet Bugs group. To unsubscribe from this group and stop receiving emails from it, send an email to puppet-bugs+unsubscr...@googlegroups.com. To post to this group, send email to puppet-bugs@googlegroups.com. Visit this group at http://groups.google.com/group/puppet-bugs. For more options, visit https://groups.google.com/d/optout.
Jira (PDB-949) Retrieving facts that have had 'trusted' facts injected into them causes a 400 Attempt to assign to a reserved variable name: 'trusted' on node failure during Puppet catalog compilati
Title: Message Title Charlie Sharpsteen commented on PDB-949 Re: Retrieving facts that have had 'trusted' facts injected into them causes a 400 Attempt to assign to a reserved variable name: 'trusted' on node failure during Puppet catalog compilation. I think the correct answer is to separate the trusted data from the fact data on the PDB side. The reason being is that these two datasets are separate attributes of the Node object, are never mixed by the compiler and always exist as distinct entities. During compilation, there are two top-scope datasets: $::trusted and $::facts, and $::facts['trusted'] is undefined. Now, this does also lead to a question for the Puppet side: if trusted data is coming from PDB or a cached Node object, instead of a live Node request, is it still trusted? Add Comment This message was sent by Atlassian JIRA (v6.3.15#6346-sha1:dbc023d) -- You received this message because you are subscribed to the Google Groups Puppet Bugs group. To unsubscribe from this group and stop receiving emails from it, send an email to puppet-bugs+unsubscr...@googlegroups.com. To post to this group, send email to puppet-bugs@googlegroups.com. Visit this group at http://groups.google.com/group/puppet-bugs. For more options, visit https://groups.google.com/d/optout.
Jira (PUP-4483) Add NotUndef type to the set of Puppet types
Title: Message Title Henrik Lindberg assigned an issue to Henrik Lindberg Puppet / PUP-4483 Add NotUndef type to the set of Puppet types Change By: Henrik Lindberg Assignee: HenrikLindberg Add Comment This message was sent by Atlassian JIRA (v6.3.15#6346-sha1:dbc023d) -- You received this message because you are subscribed to the Google Groups Puppet Bugs group. To unsubscribe from this group and stop receiving emails from it, send an email to puppet-bugs+unsubscr...@googlegroups.com. To post to this group, send email to puppet-bugs@googlegroups.com. Visit this group at http://groups.google.com/group/puppet-bugs. For more options, visit https://groups.google.com/d/optout.
Jira (PUP-4489) Add data_provider to module metadata
Title: Message Title Henrik Lindberg updated an issue Puppet / PUP-4489 Add data_provider to module metadata Change By: Henrik Lindberg Fix Version/s: PUP4.2.0 Add Comment This message was sent by Atlassian JIRA (v6.3.15#6346-sha1:dbc023d) -- You received this message because you are subscribed to the Google Groups Puppet Bugs group. To unsubscribe from this group and stop receiving emails from it, send an email to puppet-bugs+unsubscr...@googlegroups.com. To post to this group, send email to puppet-bugs@googlegroups.com. Visit this group at http://groups.google.com/group/puppet-bugs. For more options, visit https://groups.google.com/d/optout.
Jira (PUP-355) how to run rspec-puppet with data in modules
Title: Message Title Henrik Lindberg updated an issue Puppet / PUP-355 how to run rspec-puppet with data in modules Change By: Henrik Lindberg Sprint: Language2015-06-10 Add Comment This message was sent by Atlassian JIRA (v6.3.15#6346-sha1:dbc023d) -- You received this message because you are subscribed to the Google Groups Puppet Bugs group. To unsubscribe from this group and stop receiving emails from it, send an email to puppet-bugs+unsubscr...@googlegroups.com. To post to this group, send email to puppet-bugs@googlegroups.com. Visit this group at http://groups.google.com/group/puppet-bugs. For more options, visit https://groups.google.com/d/optout.
Jira (PDB-1312) When starting PDB, don’t service requests until after an initial sync completes
Title: Message Title Ryan Senior updated an issue PuppetDB / PDB-1312 When starting PDB, don’t service requests until after an initial sync completes Change By: Ryan Senior Sprint: PuppetDB2015-05-20 Add Comment This message was sent by Atlassian JIRA (v6.3.15#6346-sha1:dbc023d) -- You received this message because you are subscribed to the Google Groups Puppet Bugs group. To unsubscribe from this group and stop receiving emails from it, send an email to puppet-bugs+unsubscr...@googlegroups.com. To post to this group, send email to puppet-bugs@googlegroups.com. Visit this group at http://groups.google.com/group/puppet-bugs. For more options, visit https://groups.google.com/d/optout.
Jira (PDB-1469) puppetdb-terminus-2.3.3-1.el6 cannot find rubygems-json package
Title: Message Title Kenneth Barber updated an issue PuppetDB / PDB-1469 puppetdb-terminus-2.3.3-1.el6 cannot find rubygems-json package Change By: Kenneth Barber Sprint: PuppetDB2015-05-20 Add Comment This message was sent by Atlassian JIRA (v6.3.15#6346-sha1:dbc023d) -- You received this message because you are subscribed to the Google Groups Puppet Bugs group. To unsubscribe from this group and stop receiving emails from it, send an email to puppet-bugs+unsubscr...@googlegroups.com. To post to this group, send email to puppet-bugs@googlegroups.com. Visit this group at http://groups.google.com/group/puppet-bugs. For more options, visit https://groups.google.com/d/optout.
Jira (PDB-1484) Memory leak when 'replace facts' failing
Title: Message Title Kenneth Barber commented on PDB-1484 Re: Memory leak when 'replace facts' failing Simon Oxwell we can control the prepared-statement cache by adding a configuration option. I believe now its hard-coded to 1000 items, but since we have quite a few dynamic queries this can quickly get large. I wouldn't have expected 500 MB though, I've seen 50 MB before. Do you have a hprof dump that we can look at for this? Add Comment This message was sent by Atlassian JIRA (v6.3.15#6346-sha1:dbc023d) -- You received this message because you are subscribed to the Google Groups Puppet Bugs group. To unsubscribe from this group and stop receiving emails from it, send an email to puppet-bugs+unsubscr...@googlegroups.com. To post to this group, send email to puppet-bugs@googlegroups.com. Visit this group at http://groups.google.com/group/puppet-bugs. For more options, visit https://groups.google.com/d/optout.
Jira (PDB-1472) [Performance] Improvements for paged results
Title: Message Title Kenneth Barber updated an issue PuppetDB / PDB-1472 [Performance] Improvements for paged results Change By: Kenneth Barber Sprint: PuppetDB2015-05-20 Add Comment This message was sent by Atlassian JIRA (v6.3.15#6346-sha1:dbc023d) -- You received this message because you are subscribed to the Google Groups Puppet Bugs group. To unsubscribe from this group and stop receiving emails from it, send an email to puppet-bugs+unsubscr...@googlegroups.com. To post to this group, send email to puppet-bugs@googlegroups.com. Visit this group at http://groups.google.com/group/puppet-bugs. For more options, visit https://groups.google.com/d/optout.
Jira (FACT-956) Update puppet-agent#master to build facter#master, remove cfacter
Title: Message Title Rob Reynolds commented on FACT-956 Re: Update puppet-agent#master to build facter#master, remove cfacter Merged into master at a32d7ecd Add Comment This message was sent by Atlassian JIRA (v6.3.15#6346-sha1:dbc023d) -- You received this message because you are subscribed to the Google Groups Puppet Bugs group. To unsubscribe from this group and stop receiving emails from it, send an email to puppet-bugs+unsubscr...@googlegroups.com. To post to this group, send email to puppet-bugs@googlegroups.com. Visit this group at http://groups.google.com/group/puppet-bugs. For more options, visit https://groups.google.com/d/optout.
Jira (PDB-1467) puppetdb module has ordering problem with read_database.ini
Title: Message Title Kenneth Barber updated an issue PuppetDB / PDB-1467 puppetdb module has ordering problem with read_database.ini Change By: Kenneth Barber Component/s: Module Affects Version/s: PDBmodule-4.2.1 Sprint: PuppetDB2015-05-06 Story Points: 0 Scope Change Reason: ModulePR Scope Change Category: Found Fix Version/s: PDBmodule-4.3.0 Add Comment
Jira (PDB-1487) Add producer_timestamp to store-report
Title: Message Title Ryan Senior updated an issue PuppetDB / PDB-1487 Add producer_timestamp to store-report Change By: Ryan Senior We'recurrentlyusingstart_time,butitturnsoutthatcomesfromtheagent.Afteraddingthis,useitinthestale-nodes (andreport-ttl) query. Add Comment This message was sent by Atlassian JIRA (v6.3.15#6346-sha1:dbc023d) -- You received this message because you are subscribed to the Google Groups Puppet Bugs group. To unsubscribe from this group and stop receiving emails from it, send an email to puppet-bugs+unsubscr...@googlegroups.com. To post to this group, send email to puppet-bugs@googlegroups.com. Visit this group at http://groups.google.com/group/puppet-bugs. For more options, visit https://groups.google.com/d/optout.
Jira (PUP-4500) Common type of two strings where only one has values is too restricted
Title: Message Title Eric Thompson commented on PUP-4500 Re: Common type of two strings where only one has values is too restricted internals. low risk. resolving Add Comment This message was sent by Atlassian JIRA (v6.3.15#6346-sha1:dbc023d) -- You received this message because you are subscribed to the Google Groups Puppet Bugs group. To unsubscribe from this group and stop receiving emails from it, send an email to puppet-bugs+unsubscr...@googlegroups.com. To post to this group, send email to puppet-bugs@googlegroups.com. Visit this group at http://groups.google.com/group/puppet-bugs. For more options, visit https://groups.google.com/d/optout.
Jira (PDB-1494) Update changelog/release notes
Title: Message Title Wyatt Alt created an issue PuppetDB / PDB-1494 Update changelog/release notes Issue Type: Sub-task Assignee: Unassigned Created: 2015/05/06 9:32 AM Priority: Normal Reporter: Wyatt Alt Update the changelog/release notes in documentation/changes.md Add Comment This message was sent by Atlassian JIRA (v6.3.15#6346-sha1:dbc023d)
Jira (PDB-1315) Add sync information to metrics
Title: Message Title Ryan Senior updated an issue PuppetDB / PDB-1315 Add sync information to metrics Change By: Ryan Senior Story Points: 3 Add Comment This message was sent by Atlassian JIRA (v6.3.15#6346-sha1:dbc023d) -- You received this message because you are subscribed to the Google Groups Puppet Bugs group. To unsubscribe from this group and stop receiving emails from it, send an email to puppet-bugs+unsubscr...@googlegroups.com. To post to this group, send email to puppet-bugs@googlegroups.com. Visit this group at http://groups.google.com/group/puppet-bugs. For more options, visit https://groups.google.com/d/optout.
Jira (PUP-4501) TypeCalculator instance_of? does not consider String type values.
Title: Message Title Eric Thompson assigned an issue to Eric Thompson Puppet / PUP-4501 TypeCalculator instance_of? does not consider String type values. Change By: Eric Thompson Assignee: QA EricThompson Add Comment This message was sent by Atlassian JIRA (v6.3.15#6346-sha1:dbc023d) -- You received this message because you are subscribed to the Google Groups Puppet Bugs group. To unsubscribe from this group and stop receiving emails from it, send an email to puppet-bugs+unsubscr...@googlegroups.com. To post to this group, send email to puppet-bugs@googlegroups.com. Visit this group at http://groups.google.com/group/puppet-bugs. For more options, visit https://groups.google.com/d/optout.
Jira (PUP-1931) mount provider improvement when options property is not specified
Title: Message Title Kenn Hussey updated an issue Puppet / PUP-1931 mount provider improvement when options property is not specified Change By: Kenn Hussey Sprint: RE2015-04-08,RE2015-04-22,RE2015-05-06 ,RE2015-05-20 Add Comment This message was sent by Atlassian JIRA (v6.3.15#6346-sha1:dbc023d) -- You received this message because you are subscribed to the Google Groups Puppet Bugs group. To unsubscribe from this group and stop receiving emails from it, send an email to puppet-bugs+unsubscr...@googlegroups.com. To post to this group, send email to puppet-bugs@googlegroups.com. Visit this group at http://groups.google.com/group/puppet-bugs. For more options, visit https://groups.google.com/d/optout.
Jira (PUP-3812) Modify file_bucket_file API to use application/octet-stream instead of text/plain for Content-Type
Title: Message Title Jeremy Barlow commented on PUP-3812 Re: Modify file_bucket_file API to use application/octet-stream instead of text/plain for Content-Type I wasn't able to reproduce the failure via the use of the puppet filebucket CLI command. I wonder if this is something that can only be reproduced via the simmons module, in which case it would be helpful to have a more complete set of steps to reproduce. I was running on my OSX box from latest Puppet Server source on the master branch - git sha 32507677cc11240209b38137eec0578ac488d0b2 - and with core Ruby Puppet from the associated submodule in the Puppet Server repo - 4.0.0-rc1 (git sha 4dae4b348ab6942d07c178fd160726e2c7895eaa). Here's the sequence of steps that I followed: 1) Started the Puppet Server master. 2) Downloaded the regression-binary-blob file attached to the ticket and ran the following against it: › md5 ./regression-binary-blob MD5 (./regression-binary-blob) = 2481e1b1eff9d1c557f2cd32c8e7d059 3) Ran the following command to store the file in the bucket: puppet filebucket backup ./regression-binary-blob ... boilerplate confdir/vardir/server/certname stuff ... --http_debug In the agent output, I saw: - PUT /puppet/v3/file_bucket_file/md5/2481e1b1eff9d1c557f2cd32c8e7d059//s/repos/puppet-server/ruby/puppet/regression-binary-blob?environment=production HTTP/1.1\r\nAccept: binary\r\nX-Puppet-Version: 4.0.0-rc1\r\nAccept-Encoding: gzip;q=1.0,deflate;q=0.6,identity;q=0.3\r\nContent-Type: application/octet-stream\r\nUser-Agent: Ruby\r\nConnection: close\r\nHost: localhost:8140\r\nContent-Length: 512\r\n\r\n ... file bytes... - HTTP/1.1
Jira (PDB-1503) Push tag
Title: Message Title Wyatt Alt created an issue PuppetDB / PDB-1503 Push tag Issue Type: Sub-task Assignee: Melissa Stone Created: 2015/05/06 10:11 AM Priority: Normal Reporter: Wyatt Alt Push the tag made earlier up to the main public repo for the branch in question. Add Comment This message was sent by Atlassian JIRA (v6.3.15#6346-sha1:dbc023d) -- You
Jira (FACT-979) Facter acceptance in AIO fails due to older version of Beaker
Title: Message Title Michael Smith assigned an issue to QA Facter / FACT-979 Facter acceptance in AIO fails due to older version of Beaker Change By: Michael Smith Status: Readyfor CI Test Assignee: QA Add Comment This message was sent by Atlassian JIRA (v6.3.15#6346-sha1:dbc023d) -- You received this message because you are subscribed to the Google Groups Puppet Bugs group. To unsubscribe from this group and stop receiving emails from it, send an email to puppet-bugs+unsubscr...@googlegroups.com. To post to this group, send email to puppet-bugs@googlegroups.com. Visit this group at http://groups.google.com/group/puppet-bugs. For more options, visit https://groups.google.com/d/optout.
Jira (FACT-956) Update puppet-agent#master to build facter#master, remove cfacter
Title: Message Title Michael Smith assigned an issue to QA Facter / FACT-956 Update puppet-agent#master to build facter#master, remove cfacter Change By: Michael Smith Status: Readyfor CI Test Assignee: QA Add Comment This message was sent by Atlassian JIRA (v6.3.15#6346-sha1:dbc023d) -- You received this message because you are subscribed to the Google Groups Puppet Bugs group. To unsubscribe from this group and stop receiving emails from it, send an email to puppet-bugs+unsubscr...@googlegroups.com. To post to this group, send email to puppet-bugs@googlegroups.com. Visit this group at http://groups.google.com/group/puppet-bugs. For more options, visit https://groups.google.com/d/optout.
Jira (PDB-1362) puppetdb crashes after upgrade
Title: Message Title Kurt Wall updated an issue PuppetDB / PDB-1362 puppetdb crashes after upgrade Change By: Kurt Wall QA Status: Reviewed Add Comment This message was sent by Atlassian JIRA (v6.3.15#6346-sha1:dbc023d) -- You received this message because you are subscribed to the Google Groups Puppet Bugs group. To unsubscribe from this group and stop receiving emails from it, send an email to puppet-bugs+unsubscr...@googlegroups.com. To post to this group, send email to puppet-bugs@googlegroups.com. Visit this group at http://groups.google.com/group/puppet-bugs. For more options, visit https://groups.google.com/d/optout.
Jira (PDB-1362) puppetdb crashes after upgrade
Title: Message Title Kurt Wall updated an issue PuppetDB / PDB-1362 puppetdb crashes after upgrade Change By: Kurt Wall QA Contact: KurtWall Add Comment This message was sent by Atlassian JIRA (v6.3.15#6346-sha1:dbc023d) -- You received this message because you are subscribed to the Google Groups Puppet Bugs group. To unsubscribe from this group and stop receiving emails from it, send an email to puppet-bugs+unsubscr...@googlegroups.com. To post to this group, send email to puppet-bugs@googlegroups.com. Visit this group at http://groups.google.com/group/puppet-bugs. For more options, visit https://groups.google.com/d/optout.
Jira (PUP-4511) Types Array[?], Hash[?,?], and Optional[?] are not assignable to themselves
Title: Message Title Eric Thompson updated an issue Puppet / PUP-4511 Types Array[?], Hash[?,?], and Optional[?] are not assignable to themselves Change By: Eric Thompson The{{TypeCalculator.assignable?}}methoddoesnotconsiderthetypes{{Array[?]}},{{Hash[?,?]}},and{{Optional[?]}}tobeassignabletothemselves.h3.QArisk: medium low probability: medium low severity: medium(workaroundsinsyntax/language) low testlevel:unit Add Comment This message was sent by Atlassian JIRA (v6.3.15#6346-sha1:dbc023d) -- You received this message because you are subscribed to the Google Groups Puppet Bugs group. To unsubscribe from this group and stop receiving emails from it, send an email to puppet-bugs+unsubscr...@googlegroups.com. To post to this group, send email to puppet-bugs@googlegroups.com. Visit this group at http://groups.google.com/group/puppet-bugs. For more options, visit https://groups.google.com/d/optout.
Jira (PUP-4477) Create a base agent upgrade module for rpm-based distro
Title: Message Title Michael Smith updated an issue Puppet / PUP-4477 Create a base agent upgrade module for rpm-based distro Change By: Michael Smith Prerequisitesforthismoduletobeused:*Agentisatpuppet3.8andrunningcorrectlywithfutureparser**Onlytheversionnumberconstraintisenforcedbythemodule*Master-sideispuppetserver2.1+(i.e.supportsboth3.xand4.xnetworkAPIs)Thebaserequirementsareroughly:*checkpuppetversion**ifversion3.8,fail**ifversion=4,warn**elseupgradeIfupgrading:*Capturessldirandcopyallcertsintonewssldir*Copythecurrentpuppet.conf*Remove(orcommentout)anydeprecatedsettingsinpuppet.conf*Removedisable_warnings*Removevardir,rundir,libdirandconfdiroverrides(andanysettingsthatderivefromthosesettingsbydefault)*Installthenewagent,basedoffofPC1onyum.puppetlabs.com Note:Installingthenewagentwillusuallyremovetheoldone.Thathandoffneedsspecialattentiontogetthenewagentup-and-running. MCollective*Copyandedittheserver.cfgsimilartoPuppet*Iflibdirisset,appendnewpathstoit*Updateorreplacelogdirwiththenewlogdirvalue*Updateplugin.yamlandappendnewfactcachepathtoith3.QArisk:hightestlevel:acceptanceandunit Add Comment This message was sent by Atlassian JIRA (v6.3.15#6346-sha1:dbc023d) -- You received this message because you are subscribed to the Google Groups Puppet Bugs group. To unsubscribe from this group and stop receiving emails from it, send an email to puppet-bugs+unsubscr...@googlegroups.com. To post to this group, send email to puppet-bugs@googlegroups.com. Visit this group at http://groups.google.com/group/puppet-bugs. For more options, visit https://groups.google.com/d/optout.
Jira (PDB-1384) Test using a different database schema
Title: Message Title Kurt Wall updated an issue PuppetDB / PDB-1384 Test using a different database schema Change By: Kurt Wall SomePuppetDBusersdon'thavetheirdatabasesinthepublicschema(PDB-1363),soconsidertestingthatarrangement.OnepossibliitymightbetojustrunsomeoralloftheunittestsafterclearingthedatabaseandcallingSETSCHEMA'someotherschema'.Seemigration-in-different-schemaforsomethingsimilar(andtherelevantdbcompatibilityconditional).Althoughintheparticularcasementionedabove,theschemawassetviaALTERUSERpuppetdbSETsearch_pathto'puppet'.Whenworkingonthis,alsoconsiderthebehaviorofclear-db-for-testing!,sql-current-connection-table-names,sql-current-connection-sequence-names,index-exists?,andthepossibleobsolescenceofmigration-in-different-schema. h3.QARiskAssessment|Probability|Low||Severity|Low-failedinstallation||RiskLevel|Low||TestLevel|Unit| Add Comment This message was sent by Atlassian JIRA (v6.3.15#6346-sha1:dbc023d) -- You received this message because you are subscribed to the Google Groups Puppet Bugs group. To unsubscribe from this group and stop receiving emails from it, send an email to puppet-bugs+unsubscr...@googlegroups.com. To post to this group, send email to puppet-bugs@googlegroups.com. Visit this group at http://groups.google.com/group/puppet-bugs. For more options, visit https://groups.google.com/d/optout.
Jira (PDB-1384) Test using a different database schema
Title: Message Title Kurt Wall updated an issue PuppetDB / PDB-1384 Test using a different database schema Change By: Kurt Wall QA Status: Reviewed Add Comment This message was sent by Atlassian JIRA (v6.3.15#6346-sha1:dbc023d) -- You received this message because you are subscribed to the Google Groups Puppet Bugs group. To unsubscribe from this group and stop receiving emails from it, send an email to puppet-bugs+unsubscr...@googlegroups.com. To post to this group, send email to puppet-bugs@googlegroups.com. Visit this group at http://groups.google.com/group/puppet-bugs. For more options, visit https://groups.google.com/d/optout.
Jira (PDB-1479) Mark aggregate-event-counts event-counts API docs for removal in the future
Title: Message Title Wyatt Alt assigned an issue to Wyatt Alt PuppetDB / PDB-1479 Mark aggregate-event-counts event-counts API docs for removal in the future Change By: Wyatt Alt Assignee: WyattAlt Add Comment This message was sent by Atlassian JIRA (v6.3.15#6346-sha1:dbc023d) -- You received this message because you are subscribed to the Google Groups Puppet Bugs group. To unsubscribe from this group and stop receiving emails from it, send an email to puppet-bugs+unsubscr...@googlegroups.com. To post to this group, send email to puppet-bugs@googlegroups.com. Visit this group at http://groups.google.com/group/puppet-bugs. For more options, visit https://groups.google.com/d/optout.
Jira (PUP-3812) Modify file_bucket_file API to use application/octet-stream instead of text/plain for Content-Type
Title: Message Title Nate Wolfe assigned an issue to Unassigned Puppet / PUP-3812 Modify file_bucket_file API to use application/octet-stream instead of text/plain for Content-Type Change By: Nate Wolfe Assignee: NateWolfe Add Comment This message was sent by Atlassian JIRA (v6.3.15#6346-sha1:dbc023d) -- You received this message because you are subscribed to the Google Groups Puppet Bugs group. To unsubscribe from this group and stop receiving emails from it, send an email to puppet-bugs+unsubscr...@googlegroups.com. To post to this group, send email to puppet-bugs@googlegroups.com. Visit this group at http://groups.google.com/group/puppet-bugs. For more options, visit https://groups.google.com/d/optout.
Jira (PDB-1323) Make producer_timestamp a required field
Title: Message Title Kurt Wall updated an issue PuppetDB / PDB-1323 Make producer_timestamp a required field Change By: Kurt Wall Theproducer_timestampfieldofcatalogsandfactsetsisthebasisofconflictresolutionforHA,soweneedtomakesureit'sthere.It'scurrentlyalwaysprovidedbythemaster(viaourterminus),butweshouldchangetheAPItomakeitrequired. h3.QARiskAnalysis|Probability|Low||Severity|Medium(notcatastrophic,butinHAenv,conflictresolutionisimportant)||RiskLevel|Low(notwidelyused?)|TestLevel|Unit| Add Comment This message was sent by Atlassian JIRA (v6.3.15#6346-sha1:dbc023d) -- You received this message because you are subscribed to the Google Groups Puppet Bugs group. To unsubscribe from this group and stop receiving emails from it, send an email to puppet-bugs+unsubscr...@googlegroups.com. To post to this group, send email to puppet-bugs@googlegroups.com. Visit this group at http://groups.google.com/group/puppet-bugs. For more options, visit https://groups.google.com/d/optout.
Jira (PDB-1465) PR (1372): (maint) Detangle query-eng database and http streaming - ajroetker
Title: Message Title gepetto-bot commented on PDB-1465 Re: PR (1372): (maint) Detangle query-eng database and http streaming - ajroetker senior commented: I'm taking a look at this Add Comment This message was sent by Atlassian JIRA (v6.3.15#6346-sha1:dbc023d) -- You received this message because you are subscribed to the Google Groups Puppet Bugs group. To unsubscribe from this group and stop receiving emails from it, send an email to puppet-bugs+unsubscr...@googlegroups.com. To post to this group, send email to puppet-bugs@googlegroups.com. Visit this group at http://groups.google.com/group/puppet-bugs. For more options, visit https://groups.google.com/d/optout.
Jira (PDB-1384) Test using a different database schema
Title: Message Title Kurt Wall updated an issue PuppetDB / PDB-1384 Test using a different database schema Change By: Kurt Wall QA Contact: KurtWall Add Comment This message was sent by Atlassian JIRA (v6.3.15#6346-sha1:dbc023d) -- You received this message because you are subscribed to the Google Groups Puppet Bugs group. To unsubscribe from this group and stop receiving emails from it, send an email to puppet-bugs+unsubscr...@googlegroups.com. To post to this group, send email to puppet-bugs@googlegroups.com. Visit this group at http://groups.google.com/group/puppet-bugs. For more options, visit https://groups.google.com/d/optout.
Jira (PDB-1384) Test using a different database schema
Title: Message Title Kurt Wall updated an issue PuppetDB / PDB-1384 Test using a different database schema Change By: Kurt Wall SomePuppetDBusersdon'thavetheirdatabasesinthepublicschema(PDB-1363),soconsidertestingthatarrangement.OnepossibliitymightbetojustrunsomeoralloftheunittestsafterclearingthedatabaseandcallingSETSCHEMA'someotherschema'.Seemigration-in-different-schemaforsomethingsimilar(andtherelevantdbcompatibilityconditional).Althoughintheparticularcasementionedabove,theschemawassetviaALTERUSERpuppetdbSETsearch_pathto'puppet'.Whenworkingonthis,alsoconsiderthebehaviorofclear-db-for-testing!,sql-current-connection-table-names,sql-current-connection-sequence-names,index-exists?,andthepossibleobsolescenceofmigration-in-different-schema.h3.QARiskAssessment |Probability|Low||Severity|Low-failedinstallation||RiskLevel|Low||TestLevel|Unit| N/Afortestingtickets. Add Comment This message was sent by Atlassian JIRA (v6.3.15#6346-sha1:dbc023d) -- You received this message because you are subscribed to the Google Groups Puppet Bugs group. To unsubscribe from this group and stop receiving emails from it, send an email to puppet-bugs+unsubscr...@googlegroups.com. To post to this group, send email to puppet-bugs@googlegroups.com. Visit this group at http://groups.google.com/group/puppet-bugs. For more options, visit https://groups.google.com/d/optout.
Jira (PDB-1363) Puppetdb broken because of forced check for tables in public schema
Title: Message Title Kurt Wall updated an issue PuppetDB / PDB-1363 Puppetdb broken because of forced check for tables in public schema Change By: Kurt Wall QA Status: Reviewed Add Comment This message was sent by Atlassian JIRA (v6.3.15#6346-sha1:dbc023d) -- You received this message because you are subscribed to the Google Groups Puppet Bugs group. To unsubscribe from this group and stop receiving emails from it, send an email to puppet-bugs+unsubscr...@googlegroups.com. To post to this group, send email to puppet-bugs@googlegroups.com. Visit this group at http://groups.google.com/group/puppet-bugs. For more options, visit https://groups.google.com/d/optout.
Jira (PDB-1363) Puppetdb broken because of forced check for tables in public schema
Title: Message Title Kurt Wall updated an issue PuppetDB / PDB-1363 Puppetdb broken because of forced check for tables in public schema Change By: Kurt Wall ThefollowingcommitbreakspuppetdbinmyenvironmentbecausewedonotusethePUBLICschema.https://github.com/puppetlabs/puppetdb/commit/53210f67eb8b2223cfb719ae484313b8cec55042#diff-11e61c2a3b3f71dacf7007d803e71b3d h3.QARiskAssessment|Probability|Low||Severity|Low-failedinstallation||RiskLevel|Low||TestLevel|Unit| Add Comment This message was sent by Atlassian JIRA (v6.3.15#6346-sha1:dbc023d) -- You received this message because you are subscribed to the Google Groups Puppet Bugs group. To unsubscribe from this group and stop receiving emails from it, send an email to puppet-bugs+unsubscr...@googlegroups.com. To post to this group, send email to puppet-bugs@googlegroups.com. Visit this group at http://groups.google.com/group/puppet-bugs. For more options, visit https://groups.google.com/d/optout.
Jira (PUP-2576) Implement behavioral change in the crontab provider to allow more drastic purging
Title: Message Title Zee Alexander commented on PUP-2576 Re: Implement behavioral change in the crontab provider to allow more drastic purging Can somebody clarify for me exactly what the behavioral change is here? It's not clear to me from reading the tickets Add Comment This message was sent by Atlassian JIRA (v6.3.15#6346-sha1:dbc023d) -- You received this message because you are subscribed to the Google Groups Puppet Bugs group. To unsubscribe from this group and stop receiving emails from it, send an email to puppet-bugs+unsubscr...@googlegroups.com. To post to this group, send email to puppet-bugs@googlegroups.com. Visit this group at http://groups.google.com/group/puppet-bugs. For more options, visit https://groups.google.com/d/optout.
Jira (PUP-3812) Modify file_bucket_file API to use application/octet-stream instead of text/plain for Content-Type
Title: Message Title Nate Wolfe commented on PUP-3812 Re: Modify file_bucket_file API to use application/octet-stream instead of text/plain for Content-Type Erik Dasher I cannot reproduce this either. I tried a slimmed-down minimal manifest with the file under question but had no problems backing it up during an agent run. It was definitely an error when I encountered this in the wild as the file was not backed up or modified with the new contents. For reference, I was using the following module when the error occurred: https://forge.puppetlabs.com/nwolfe/simmons v0.1.0 ...which has the following resource that generated the regression-binary-blob (which was named source-file during the agent run) file: exec { 'change-source-file': command = bash -c 'dd if=/dev/urandom bs=512 count=1 ${studio}/source-file', } As you can see, the contents are random, so I happened to get (un)lucky during that particular agent run. I'm going to re-Close this since we're not able to reproduce. Add Comment This message was sent by Atlassian JIRA
Jira (PDB-1323) Make producer_timestamp a required field
Title: Message Title Kurt Wall updated an issue PuppetDB / PDB-1323 Make producer_timestamp a required field Change By: Kurt Wall QA Contact: KurtWall Add Comment This message was sent by Atlassian JIRA (v6.3.15#6346-sha1:dbc023d) -- You received this message because you are subscribed to the Google Groups Puppet Bugs group. To unsubscribe from this group and stop receiving emails from it, send an email to puppet-bugs+unsubscr...@googlegroups.com. To post to this group, send email to puppet-bugs@googlegroups.com. Visit this group at http://groups.google.com/group/puppet-bugs. For more options, visit https://groups.google.com/d/optout.
Jira (PDB-1323) Make producer_timestamp a required field
Title: Message Title Kurt Wall updated an issue PuppetDB / PDB-1323 Make producer_timestamp a required field Change By: Kurt Wall QA Status: Reviewed Add Comment This message was sent by Atlassian JIRA (v6.3.15#6346-sha1:dbc023d) -- You received this message because you are subscribed to the Google Groups Puppet Bugs group. To unsubscribe from this group and stop receiving emails from it, send an email to puppet-bugs+unsubscr...@googlegroups.com. To post to this group, send email to puppet-bugs@googlegroups.com. Visit this group at http://groups.google.com/group/puppet-bugs. For more options, visit https://groups.google.com/d/optout.
Jira (PDB-1479) Mark aggregate-event-counts event-counts API docs for removal in the future
Title: Message Title Wyatt Alt updated an issue PuppetDB / PDB-1479 Mark aggregate-event-counts event-counts API docs for removal in the future Change By: Wyatt Alt Sprint: PuppetDB2015- 06 05 - 03 20 Add Comment This message was sent by Atlassian JIRA (v6.3.15#6346-sha1:dbc023d) -- You received this message because you are subscribed to the Google Groups Puppet Bugs group. To unsubscribe from this group and stop receiving emails from it, send an email to puppet-bugs+unsubscr...@googlegroups.com. To post to this group, send email to puppet-bugs@googlegroups.com. Visit this group at http://groups.google.com/group/puppet-bugs. For more options, visit https://groups.google.com/d/optout.
Jira (FACT-963) Remove pre-suite environment setup for AIO
Title: Message Title Michael Smith assigned an issue to QA Facter / FACT-963 Remove pre-suite environment setup for AIO Change By: Michael Smith Status: Readyfor CI Test Assignee: QA Add Comment This message was sent by Atlassian JIRA (v6.3.15#6346-sha1:dbc023d) -- You received this message because you are subscribed to the Google Groups Puppet Bugs group. To unsubscribe from this group and stop receiving emails from it, send an email to puppet-bugs+unsubscr...@googlegroups.com. To post to this group, send email to puppet-bugs@googlegroups.com. Visit this group at http://groups.google.com/group/puppet-bugs. For more options, visit https://groups.google.com/d/optout.
Jira (PUP-1985) Allow class define parameters to reference earlier parameters
Title: Message Title Owen Rodabaugh updated an issue Puppet / PUP-1985 Allow class define parameters to reference earlier parameters Change By: Owen Rodabaugh CS Priority: NeedsPriority Add Comment This message was sent by Atlassian JIRA (v6.3.15#6346-sha1:dbc023d) -- You received this message because you are subscribed to the Google Groups Puppet Bugs group. To unsubscribe from this group and stop receiving emails from it, send an email to puppet-bugs+unsubscr...@googlegroups.com. To post to this group, send email to puppet-bugs@googlegroups.com. Visit this group at http://groups.google.com/group/puppet-bugs. For more options, visit https://groups.google.com/d/optout.
Jira (PDB-1362) puppetdb crashes after upgrade
Title: Message Title Kurt Wall updated an issue PuppetDB / PDB-1362 puppetdb crashes after upgrade Change By: Kurt Wall HiGang,IjustupgradedtoPuppetDB2.3.1from2.3.0inmydevelopmentenvironmentandPuppetDBcrashedonrestart.Ifyouneedmoreinformationletmeknow.Theresultinglogmessages.2015-04-0108:44:51,294INFO[o.e.j.u.log]Logginginitialized@24441ms2015-04-0108:44:52,110INFO[p.t.s.w.jetty9-core]RemovingbuggysecurityproviderSunPKCS11-NSSversion1.72015-04-0108:44:52,636INFO[p.t.s.w.jetty9-service]Initializingwebserver(s).2015-04-0108:44:52,642INFO[p.t.s.w.jetty9-service]Startingwebserver(s).2015-04-0108:44:52,818INFO[p.t.s.w.jetty9-core]Startingwebserver.2015-04-0108:44:52,822INFO[o.e.j.s.Server]jetty-9.2.z-SNAPSHOT2015-04-0108:44:52,874INFO[o.e.j.s.ServerConnector]StartedServerConnector@66ace155{HTTP/1.1}{localhost:8080}2015-04-0108:44:53,150INFO[o.e.j.s.ServerConnector]StartedServerConnector@7f17e429{SSL-HTTP/1.1}{0.0.0.0:8081}2015-04-0108:44:53,151INFO[o.e.j.s.Server]Started@26300ms2015-04-0108:44:53,228INFO[c.p.p.c.services]PuppetDBversion2.3.12015-04-0108:44:53,362INFO[c.p.p.s.migrate]Applyingdatabasemigrationversion282015-04-0108:44:53,396ERROR[c.p.p.s.migrate]CaughtSQLExceptionduringmigrationjava.sql.BatchUpdateException:Batchentry5DELETEFROMfact_pathst1WHEREt1.id(SELECTMIN(t2.id)FROMfact_pathst2WHEREt1.path=t2.path)wasaborted.CallgetNextExceptiontoseethecause. atorg.postgresql.jdbc2.AbstractJdbc2Statement$BatchResultHandler.handleError(AbstractJdbc2Statement.java:2746)~[puppetdb.jar:na] atorg.postgresql.core.v3.QueryExecutorImpl$1.handleError(QueryExecutorImpl.java:457)~[puppetdb.jar:na] atorg.postgresql.core.v3.QueryExecutorImpl.processResults(QueryExecutorImpl.java:1887)~[puppetdb.jar:na] atorg.postgresql.core.v3.QueryExecutorImpl.execute(QueryExecutorImpl.java:405)~[puppetdb.jar:na] atorg.postgresql.jdbc2.AbstractJdbc2Statement.executeBatch(AbstractJdbc2Statement.java:2893)~[puppetdb.jar:na] atcom.jolbox.bonecp.StatementHandle.executeBatch(StatementHandle.java:469)~[puppetdb.jar:na] atclojure.java.jdbc$do_commands$fn__7301.invoke(jdbc.clj:188)~[na:na] atclojure.java.jdbc.internal$transaction_STAR_.invoke(internal.clj:223)[na:na] atclojure.java.jdbc$do_commands.doInvoke(jdbc.clj:187)~[na:na] atclojure.lang.RestFn.invoke(RestFn.java:3894)[puppetdb.jar:na] atcom.puppetlabs.puppetdb.scf.migrate$lift_fact_paths_into_facts.invoke(migrate.clj:968)~[na:na] atcom.puppetlabs.puppetdb.scf.migrate$migrate_BANG_$fn__20902$fn__20915.invoke(migrate.clj:1063)~[na:na] atcom.puppetlabs.puppetdb.scf.migrate$migrate_BANG_$fn__20902.invoke(migrate.clj:1062)[na:na] atclojure.java.jdbc.internal$transaction_STAR_.invoke(internal.clj:204)[na:na] atcom.puppetlabs.puppetdb.scf.migrate$migrate_BANG_.invoke(migrate.clj:1059)[na:na] atcom.puppetlabs.puppetdb.cli.services$start_puppetdb$fn__21109.invoke(services.clj:292)[na:na] atclojure.java.jdbc.internal$with_connection_STAR_.invoke(internal.clj:186)[na:na] atcom.puppetlabs.puppetdb.cli.services$start_puppetdb.invoke(services.clj:290)[na:na] atcom.puppetlabs.puppetdb.cli.services$reify__21157$service_fnk__18232__auto___positional$reify__21168.start(services.clj:366)[na:na] atpuppetlabs.trapperkeeper.services$eval18068$fn__18082$G__18058__18085.invoke(services.clj:10)[na:na]
Jira (PDB-1180) Status: (query) Ensure aggregated functionality is designed well in detail
Title: Message Title Kurt Wall updated an issue PuppetDB / PDB-1180 Status: (query) Ensure aggregated functionality is designed well in detail Change By: Kurt Wall Designdoc:https://docs.google.com/a/puppetlabs.com/document/d/1oxr-YATkV8E67Gq1YJ8vfsxazAp0DKSagAPTUbxOn4g/edit#Thisisapre-tasktoaggregatefunctionstoensurewedesigntheaggregateoperatorproperly,andthatwecanprovethisisaviableoptionbydoingaquickPoConit.Wealreadyhavearoughdesigninthedesigndoc.h3.QARiskAssessmentN/Afordesigntickets Add Comment This message was sent by Atlassian JIRA (v6.3.15#6346-sha1:dbc023d) -- You received this message because you are subscribed to the Google Groups Puppet Bugs group. To unsubscribe from this group and stop receiving emails from it, send an email to puppet-bugs+unsubscr...@googlegroups.com. To post to this group, send email to puppet-bugs@googlegroups.com. Visit this group at http://groups.google.com/group/puppet-bugs. For more options, visit https://groups.google.com/d/optout.
Jira (PDB-1180) Status: (query) Ensure aggregated functionality is designed well in detail
Title: Message Title Kurt Wall updated an issue PuppetDB / PDB-1180 Status: (query) Ensure aggregated functionality is designed well in detail Change By: Kurt Wall QA Status: Reviewed Add Comment This message was sent by Atlassian JIRA (v6.3.15#6346-sha1:dbc023d) -- You received this message because you are subscribed to the Google Groups Puppet Bugs group. To unsubscribe from this group and stop receiving emails from it, send an email to puppet-bugs+unsubscr...@googlegroups.com. To post to this group, send email to puppet-bugs@googlegroups.com. Visit this group at http://groups.google.com/group/puppet-bugs. For more options, visit https://groups.google.com/d/optout.
Jira (PDB-1180) Status: (query) Ensure aggregated functionality is designed well in detail
Title: Message Title Kurt Wall updated an issue PuppetDB / PDB-1180 Status: (query) Ensure aggregated functionality is designed well in detail Change By: Kurt Wall QA Contact: KurtWall Add Comment This message was sent by Atlassian JIRA (v6.3.15#6346-sha1:dbc023d) -- You received this message because you are subscribed to the Google Groups Puppet Bugs group. To unsubscribe from this group and stop receiving emails from it, send an email to puppet-bugs+unsubscr...@googlegroups.com. To post to this group, send email to puppet-bugs@googlegroups.com. Visit this group at http://groups.google.com/group/puppet-bugs. For more options, visit https://groups.google.com/d/optout.
Jira (PDB-1180) Status: (query) Ensure aggregated functionality is designed well in detail
Title: Message Title Kurt Wall updated an issue PuppetDB / PDB-1180 Status: (query) Ensure aggregated functionality is designed well in detail Change By: Kurt Wall Designdoc:https://docs.google.com/a/puppetlabs.com/document/d/1oxr-YATkV8E67Gq1YJ8vfsxazAp0DKSagAPTUbxOn4g/edit#Thisisapre-tasktoaggregatefunctionstoensurewedesigntheaggregateoperatorproperly,andthatwecanprovethisisaviableoptionbydoingaquickPoConit.Wealreadyhavearoughdesigninthedesigndoc. Add Comment This message was sent by Atlassian JIRA (v6.3.15#6346-sha1:dbc023d) -- You received this message because you are subscribed to the Google Groups Puppet Bugs group. To unsubscribe from this group and stop receiving emails from it, send an email to puppet-bugs+unsubscr...@googlegroups.com. To post to this group, send email to puppet-bugs@googlegroups.com. Visit this group at http://groups.google.com/group/puppet-bugs. For more options, visit https://groups.google.com/d/optout.
Jira (PDB-1180) Status: (query) Ensure aggregated functionality is designed well in detail
Title: Message Title Kurt Wall updated an issue PuppetDB / PDB-1180 Status: (query) Ensure aggregated functionality is designed well in detail Change By: Kurt Wall Designdoc:https://docs.google.com/a/puppetlabs.com/document/d/1oxr-YATkV8E67Gq1YJ8vfsxazAp0DKSagAPTUbxOn4g/edit#Thisisapre-tasktoaggregatefunctionstoensurewedesigntheaggregateoperatorproperly,andthatwecanprovethisisaviableoptionbydoingaquickPoConit.Wealreadyhavearoughdesigninthedesigndoc. h3.QARiskAssessmentN/Afordesigntickets Add Comment This message was sent by Atlassian JIRA (v6.3.15#6346-sha1:dbc023d) -- You received this message because you are subscribed to the Google Groups Puppet Bugs group. To unsubscribe from this group and stop receiving emails from it, send an email to puppet-bugs+unsubscr...@googlegroups.com. To post to this group, send email to puppet-bugs@googlegroups.com. Visit this group at http://groups.google.com/group/puppet-bugs. For more options, visit https://groups.google.com/d/optout.
Jira (PUP-4483) Add NotUndef type to the set of Puppet types
Title: Message Title Henrik Lindberg commented on PUP-4483 Re: Add NotUndef type to the set of Puppet types specification merged at: 32acd5b (puppet-specifications master) Add Comment This message was sent by Atlassian JIRA (v6.3.15#6346-sha1:dbc023d) -- You received this message because you are subscribed to the Google Groups Puppet Bugs group. To unsubscribe from this group and stop receiving emails from it, send an email to puppet-bugs+unsubscr...@googlegroups.com. To post to this group, send email to puppet-bugs@googlegroups.com. Visit this group at http://groups.google.com/group/puppet-bugs. For more options, visit https://groups.google.com/d/optout.
Jira (PDB-1465) PR (1372): (maint) Detangle query-eng database and http streaming - ajroetker
Title: Message Title gepetto-bot commented on PDB-1465 Re: PR (1372): (maint) Detangle query-eng database and http streaming - ajroetker ajroetker commented: @pljenkinsro retest this please Add Comment This message was sent by Atlassian JIRA (v6.3.15#6346-sha1:dbc023d) -- You received this message because you are subscribed to the Google Groups Puppet Bugs group. To unsubscribe from this group and stop receiving emails from it, send an email to puppet-bugs+unsubscr...@googlegroups.com. To post to this group, send email to puppet-bugs@googlegroups.com. Visit this group at http://groups.google.com/group/puppet-bugs. For more options, visit https://groups.google.com/d/optout.
Jira (PUP-4483) Add NotUndef type to the set of Puppet types
Title: Message Title Thomas Hallgren updated an issue Puppet / PUP-4483 Add NotUndef type to the set of Puppet types Change By: Thomas Hallgren ThePuppettypesystemhascurrentlynowayofdefiningatypewiththemeaninganyvalueexceptundefinedandhencenowayofdifferentiatingbetweenamissingvalueandagivenvalueofanytype(theexisting{{Any}}typeaccepts{{undef}}values).Theproblembecomesapparentwhendeclaringahashwherecertainentriesmustbepresentbutthevalueisunrestricted. Twoimprovementsareneededinordertofullyresolvethisissue:.h3 Adding a Undef[T]Anewparameterizedtype {{NotUndef [T] }} shouldbeaddedthatwillreflectatypethatisassignablefromalltypesthat{{T}}isassignablefromwiththeexceptionofalltypesthatareassignablefrom{{Undef}}.Theparameter{{T}}isoptionalanddefaultsto{{Any}}.Thedefaulttypewillbeespeciallyusefulwhendeclaringuntypedparameters(thatrequireavalue wouldresolvetheissuebutthesolutionisnotidealsincethevaluethenbecomesrestricted(itcannotbe{{undef}}).It'sstillnotpossibletodifferentiatebetweenamissingkeyandakeywiththevalueundef.Thisdifferentiationcanbesignificantwhenvariantsareusingdifferentsetsofkeys.Toreallysolvetheproblem,wewouldneedawaytodeclarea{{Struct}}keytoberequiredoroptionalinadditiontoaddingthe{{NotUndef}}type.Onewayofdoingthiswouldbetocheckifthevalueisoftype{{Optional}},andifitis,considerthekeytobeoptional.{{Optional[Any]}}wouldthenbedifferentfrom{{Any}}inthattheformeraffectsthekey.h3.QArisk:mediumprobability:lowseverity:mediumtestlevel:unit Add Comment This message was sent by Atlassian JIRA (v6.3.15#6346-sha1:dbc023d) -- You received this message because you are subscribed to
Jira (PUP-4483) Add NotUndef type to the set of Puppet types
Title: Message Title Thomas Hallgren updated an issue Puppet / PUP-4483 Add NotUndef type to the set of Puppet types Change By: Thomas Hallgren ThePuppettypesystemhascurrentlynowayofdefiningatypewiththemeaninganyvalueexceptundefinedandhencenowayofdifferentiatingbetweenamissingvalueandagivenvalueofanytype(theexisting{{Any}}typeaccepts{{undef}}values).Theproblembecomesapparentwhendeclaringahashwherecertainentriesmustbepresentbutthevalueisunrestricted.Twoimprovementsareneededinordertofullyresolvethisissue: h3 h4 .AddingNotUndef \ [T \ ]Anewparameterizedtype{{NotUndef \ [T \ ]}}shouldbeadded thatwill to reflectatypethatisassignablefromalltypesthat{{T}}isassignablefrom withtheexceptionof except alltypesthatareassignablefrom{{Undef}}.Theparameter{{T}}isoptionalanddefaultsto{{Any}}.Thedefaulttypewillbeespeciallyusefulwhendeclaringuntypedparameters ( thatrequireavalue (suchascurrent{{Resource}}parametersthathavenodefault). wouldresolvetheissuebutthesolution h4.StructmemberkeyasTypeThekeyofaStructmembercancurrentlyonlybeastring.This is notideal toolimited since thevaluethenbecomesrestricted( it cannotbe 'simpossibletodeclarethatanentryisrequiredevenwhenit'sOKtopass {{undef}} ) asthatentry'svalue .It's still also notpossibleto differentiatebetweenamissingkeyandakeywith declarethat the value entryisoptionalbutifit'sprovided,itcannotbe{{ undef }} . Thisdifferentiationcanbesignificantwhenvariantsareusingdifferentsetsofkeys ThekeyshouldthereforeacceptaType . Toreallysolvetheproblem TheTypemustbelimitedsuchthatitmustbepossibletoextractanon-emptystring , wewouldneed i.e.an{{Enum}}withexactlyoneentryor a waytodeclare Stringthatisinferredfrom a literalnon-emptystring.Thistypecanthenbewrappedinan {{ Struct NotUndef }} key or{{Optional}} to be explicitlydeclareiftheentryis requiredoroptional inaddition .Keysdeclaredasstringliteralswillbeautomaticallyconverted to addingthe theircorresponding {{ NotUndef String }}type. Onewayofdoingthiswouldbetocheckif If thevalue isof type oftheentryisassignablefrom {{ Optional Undef }}, andifitis,considerthekeytobeoptional. thenthat {{ Optional[Any] String }} wouldthen typewill be differentfrom wrappedina {{ Any Optional }} inthattheformeraffectsthekey . Thisspecialrulewillonlyapplywhenkeysaregivenasstringliterals. h3.QArisk:mediumprobability:lowseverity:mediumtestlevel:unit Add Comment
Jira (PDB-1412) Update our gem dependencies, specifically rspec and company
Title: Message Title Wyatt Alt commented on PDB-1412 Re: Update our gem dependencies, specifically rspec and company I'm removing 2.3.x as a fix version here so I don't get confused. I'll add it back in a bit later. Add Comment This message was sent by Atlassian JIRA (v6.3.15#6346-sha1:dbc023d) -- You received this message because you are subscribed to the Google Groups Puppet Bugs group. To unsubscribe from this group and stop receiving emails from it, send an email to puppet-bugs+unsubscr...@googlegroups.com. To post to this group, send email to puppet-bugs@googlegroups.com. Visit this group at http://groups.google.com/group/puppet-bugs. For more options, visit https://groups.google.com/d/optout.
Jira (PDB-1300) Make acceptance tests compatible with Puppet 4.0
Title: Message Title Wyatt Alt commented on PDB-1300 Re: Make acceptance tests compatible with Puppet 4.0 I'm removing 2.3.x as a fix version so it doesn't confuse the 2.3.4 release in progress. I'll add it back in later. Add Comment This message was sent by Atlassian JIRA (v6.3.15#6346-sha1:dbc023d) -- You received this message because you are subscribed to the Google Groups Puppet Bugs group. To unsubscribe from this group and stop receiving emails from it, send an email to puppet-bugs+unsubscr...@googlegroups.com. To post to this group, send email to puppet-bugs@googlegroups.com. Visit this group at http://groups.google.com/group/puppet-bugs. For more options, visit https://groups.google.com/d/optout.
Jira (PDB-1465) PR (1372): (maint) Detangle query-eng database and http streaming - ajroetker
Title: Message Title gepetto-bot commented on PDB-1465 Re: PR (1372): (maint) Detangle query-eng database and http streaming - ajroetker pljenkinsro commented: Test PASSed. Refer to this link for build results (access rights to CI server needed): https://jenkins.puppetlabs.com/job/platform_puppetdb_intn-sys_pr/1172/ Add Comment This message was sent by Atlassian JIRA (v6.3.15#6346-sha1:dbc023d) -- You received this message because you are subscribed to the Google Groups Puppet Bugs group. To unsubscribe from this group and stop receiving emails from it, send an email to puppet-bugs+unsubscr...@googlegroups.com. To post to this group, send email to puppet-bugs@googlegroups.com. Visit this group at http://groups.google.com/group/puppet-bugs. For more options, visit https://groups.google.com/d/optout.
Jira (PDB-1492) PuppetDB 2.3.4 Release
Title: Message Title Wyatt Alt created an issue PuppetDB / PDB-1492 PuppetDB 2.3.4 Release Issue Type: Task Assignee: Wyatt Alt Created: 2015/05/06 9:23 AM Priority: Normal Reporter: Wyatt Alt See https://confluence.puppetlabs.com/display/DEL/FOSS+Release+Process Add Comment This message was sent by Atlassian JIRA (v6.3.15#6346-sha1:dbc023d) -- You received
Jira (PDB-1498) Is there a commit for every bug targeted at the release?
Title: Message Title Wyatt Alt created an issue PuppetDB / PDB-1498 Is there a commit for every bug targeted at the release? Issue Type: Sub-task Assignee: Unassigned Created: 2015/05/06 9:49 AM Priority: Normal Reporter: Wyatt Alt Ensure that all tickets targetted at this release have corresponding commits in git. Add Comment This message was sent by Atlassian JIRA (v6.3.15#6346-sha1:dbc023d)
Jira (PDB-1502) Packages pushed
Title: Message Title Wyatt Alt created an issue PuppetDB / PDB-1502 Packages pushed Issue Type: Sub-task Assignee: Melissa Stone Created: 2015/05/06 10:07 AM Priority: Normal Reporter: Wyatt Alt Distribute the packages previously built into their public places. Add Comment This message was sent by Atlassian JIRA (v6.3.15#6346-sha1:dbc023d) -- You received
Jira (PUP-4329) Filebucket fails to update file resource if checksum doesn't match the configured checksum type
Title: Message Title Michael Smith commented on PUP-4329 Re: Filebucket fails to update file resource if checksum doesn't match the configured checksum type I pulled it in mostly to remind myself to look into it further. Can pull it back out of the sprint. I suspect there are ways to decompose it, but haven't thought about it much yet. It seems potentially tricky, because the filebucket could end up with multiple checksum references to the same file, and there's no clean way to do that. Add Comment This message was sent by Atlassian JIRA (v6.3.15#6346-sha1:dbc023d) -- You received this message because you are subscribed to the Google Groups Puppet Bugs group. To unsubscribe from this group and stop receiving emails from it, send an email to puppet-bugs+unsubscr...@googlegroups.com. To post to this group, send email to puppet-bugs@googlegroups.com. Visit this group at http://groups.google.com/group/puppet-bugs. For more options, visit https://groups.google.com/d/optout.
Jira (PUP-4329) Filebucket fails to update file resource if checksum doesn't match the configured checksum type
Title: Message Title Michael Smith updated an issue Puppet / PUP-4329 Filebucket fails to update file resource if checksum doesn't match the configured checksum type Change By: Michael Smith Sprint: Client2015-06-10 Add Comment This message was sent by Atlassian JIRA (v6.3.15#6346-sha1:dbc023d) -- You received this message because you are subscribed to the Google Groups Puppet Bugs group. To unsubscribe from this group and stop receiving emails from it, send an email to puppet-bugs+unsubscr...@googlegroups.com. To post to this group, send email to puppet-bugs@googlegroups.com. Visit this group at http://groups.google.com/group/puppet-bugs. For more options, visit https://groups.google.com/d/optout.
Jira (PUP-4473) Extend file-based ENC spec tests to include Windows
Title: Message Title Michael Smith assigned an issue to Michael Smith Puppet / PUP-4473 Extend file-based ENC spec tests to include Windows Change By: Michael Smith Assignee: MichaelSmith Add Comment This message was sent by Atlassian JIRA (v6.3.15#6346-sha1:dbc023d) -- You received this message because you are subscribed to the Google Groups Puppet Bugs group. To unsubscribe from this group and stop receiving emails from it, send an email to puppet-bugs+unsubscr...@googlegroups.com. To post to this group, send email to puppet-bugs@googlegroups.com. Visit this group at http://groups.google.com/group/puppet-bugs. For more options, visit https://groups.google.com/d/optout.
Jira (PUP-4386) Windows Group resource reports errors incorrectly when specifying an invalid group member
Title: Message Title Steve Barlow updated an issue Puppet / PUP-4386 Windows Group resource reports errors incorrectly when specifying an invalid group member Change By: Steve Barlow Sprint: Windows2015- 05 06 - 20 03 Add Comment This message was sent by Atlassian JIRA (v6.3.15#6346-sha1:dbc023d) -- You received this message because you are subscribed to the Google Groups Puppet Bugs group. To unsubscribe from this group and stop receiving emails from it, send an email to puppet-bugs+unsubscr...@googlegroups.com. To post to this group, send email to puppet-bugs@googlegroups.com. Visit this group at http://groups.google.com/group/puppet-bugs. For more options, visit https://groups.google.com/d/optout.
Jira (PDB-1412) Update our gem dependencies, specifically rspec and company
Title: Message Title Wyatt Alt updated an issue PuppetDB / PDB-1412 Update our gem dependencies, specifically rspec and company Change By: Wyatt Alt Fix Version/s: PDB2.3.x Add Comment This message was sent by Atlassian JIRA (v6.3.15#6346-sha1:dbc023d) -- You received this message because you are subscribed to the Google Groups Puppet Bugs group. To unsubscribe from this group and stop receiving emails from it, send an email to puppet-bugs+unsubscr...@googlegroups.com. To post to this group, send email to puppet-bugs@googlegroups.com. Visit this group at http://groups.google.com/group/puppet-bugs. For more options, visit https://groups.google.com/d/optout.
Jira (PUP-4501) TypeCalculator instance_of? does not consider String type values.
Title: Message Title Thomas Hallgren commented on PUP-4501 Re: TypeCalculator instance_of? does not consider String type values. This is also something that, as far as I can tell, cannot be reproduced in Puppet language. When the type of string literal, say 'hello' is inferred, it yields a String type that only accepts the string 'hello' and no other strings. The only way to create such a type is to infer it and there's currently no way to do that in Puppet. A type_of(v) function has been considered (and an implementation exists) but it has not been included in puppet yet. Add Comment This message was sent by Atlassian JIRA (v6.3.15#6346-sha1:dbc023d) -- You received this message because you are subscribed to the Google Groups Puppet Bugs group. To unsubscribe from this group and stop receiving emails from it, send an email to puppet-bugs+unsubscr...@googlegroups.com. To post to this group, send email to puppet-bugs@googlegroups.com. Visit this group at http://groups.google.com/group/puppet-bugs. For more options, visit https://groups.google.com/d/optout.
Jira (FACT-628) facter returns incorrect value for `facter virtual` for Ldoms due to how the fact is added in Solaris.
Title: Message Title Eric Sorenson updated an issue Facter / FACT-628 facter returns incorrect value for `facter virtual` for Ldoms due to how the fact is added in Solaris. Change By: Eric Sorenson Affects Version/s: FACT2.3.0 Add Comment This message was sent by Atlassian JIRA (v6.3.15#6346-sha1:dbc023d) -- You received this message because you are subscribed to the Google Groups Puppet Bugs group. To unsubscribe from this group and stop receiving emails from it, send an email to puppet-bugs+unsubscr...@googlegroups.com. To post to this group, send email to puppet-bugs@googlegroups.com. Visit this group at http://groups.google.com/group/puppet-bugs. For more options, visit https://groups.google.com/d/optout.
Jira (PUP-4050) Acceptance suite and install.rb use incorrect paths on Windows for codedir
Title: Message Title Steve Barlow updated an issue Puppet / PUP-4050 Acceptance suite and install.rb use incorrect paths on Windows for codedir Change By: Steve Barlow Sprint: Windows2015-03-11,Windows2015-03-25,Windows2015-04-08,Windows2015-04-22,Windows2015-05-06 ,Windows2015-05-20 Add Comment This message was sent by Atlassian JIRA (v6.3.15#6346-sha1:dbc023d) -- You received this message because you are subscribed to the Google Groups Puppet Bugs group. To unsubscribe from this group and stop receiving emails from it, send an email to puppet-bugs+unsubscr...@googlegroups.com. To post to this group, send email to puppet-bugs@googlegroups.com. Visit this group at http://groups.google.com/group/puppet-bugs. For more options, visit https://groups.google.com/d/optout.
Jira (PUP-4373) Windows ADSI User groups property should behave similarly to Groups members property
Title: Message Title Steve Barlow updated an issue Puppet / PUP-4373 Windows ADSI User groups property should behave similarly to Groups members property Change By: Steve Barlow Sprint: Windows2015-04-08,Windows2015-04-22,Windows2015-05-06 ,Windows2015-05-20 Add Comment This message was sent by Atlassian JIRA (v6.3.15#6346-sha1:dbc023d) -- You received this message because you are subscribed to the Google Groups Puppet Bugs group. To unsubscribe from this group and stop receiving emails from it, send an email to puppet-bugs+unsubscr...@googlegroups.com. To post to this group, send email to puppet-bugs@googlegroups.com. Visit this group at http://groups.google.com/group/puppet-bugs. For more options, visit https://groups.google.com/d/optout.
Jira (PUP-4483) Add NotUndef type to the set of Puppet types
Title: Message Title Henrik Lindberg updated an issue Puppet / PUP-4483 Add NotUndef type to the set of Puppet types Change By: Henrik Lindberg ThePuppettypesystemhascurrentlynowayofdefiningatypewiththemeaninganyvalueexceptundefinedandhencenowayofdifferentiatingbetweenamissingvalueandagivenvalueofanytype(theexisting{{Any}}typeaccepts{{undef}}values).Theproblembecomesapparentwhendeclaringahashwherecertainentriesmustbepresentbutthevalueisunrestricted.Twoimprovementsareneededinordertofullyresolvethisissue: . h3 . Adding Undef NotUndef [T]Anewparameterizedtype{{NotUndef[T]}}shouldbeaddedthatwillreflectatypethatisassignablefromalltypesthat{{T}}isassignablefromwiththeexceptionofalltypesthatareassignablefrom{{Undef}}.Theparameter{{T}}isoptionalanddefaultsto{{Any}}.Thedefaulttypewillbeespeciallyusefulwhendeclaringuntypedparameters(thatrequireavaluewouldresolvetheissuebutthesolutionisnotidealsincethevaluethenbecomesrestricted(itcannotbe{{undef}}).It'sstillnotpossibletodifferentiatebetweenamissingkeyandakeywiththevalueundef.Thisdifferentiationcanbesignificantwhenvariantsareusingdifferentsetsofkeys.Toreallysolvetheproblem,wewouldneedawaytodeclarea{{Struct}}keytoberequiredoroptionalinadditiontoaddingthe{{NotUndef}}type.Onewayofdoingthiswouldbetocheckifthevalueisoftype{{Optional}},andifitis,considerthekeytobeoptional.{{Optional[Any]}}wouldthenbedifferentfrom{{Any}}inthattheformeraffectsthekey.h3.QArisk:mediumprobability:lowseverity:mediumtestlevel:unit Add Comment This message was sent by Atlassian JIRA (v6.3.15#6346-sha1:dbc023d) -- You received this message because you are
Jira (PDB-1470) PR (1374): (maint) make facts response streaming - wkalt
Title: Message Title Wyatt Alt updated an issue PuppetDB / PDB-1470 PR (1374): (maint) make facts response streaming - wkalt Change By: Wyatt Alt h2. r (maint)makefactsresponsestreaming*Author:WyattAlt*Company:*GithubID:[wkalt|https://github.com/wkalt]*[PullRequest1374Discussion|https://github.com/puppetlabs/puppetdb/pull/1374]*[PullRequest1374FileDiff|https://github.com/puppetlabs/puppetdb/pull/1374/files]h2.PullRequestDescriptionPreviouslyweweremistakenlyrealizingthevalueofourfactsresponsebyvalidatingitasacollection.Thischangesthevalidationsothatitisappliedonaper-elementbasisanddoesn'tdisruptthelazinessoftheresponse.(webhooks-id:6d977b7fb65463bde64c0d908909fadc) Add Comment This message was sent by Atlassian JIRA (v6.3.15#6346-sha1:dbc023d) -- You received this message because you are subscribed to the Google Groups Puppet Bugs group. To unsubscribe from this group and stop receiving emails from it, send an email to puppet-bugs+unsubscr...@googlegroups.com. To post to this group, send email to puppet-bugs@googlegroups.com. Visit this group at http://groups.google.com/group/puppet-bugs. For more options, visit https://groups.google.com/d/optout.
Jira (PDB-1470) PR (1374): (maint) make facts response streaming - wkalt
Title: Message Title Wyatt Alt updated an issue PuppetDB / PDB-1470 PR (1374): (maint) make facts response streaming - wkalt Change By: Wyatt Alt Affects Version/s: PDB2.3.3 Fix Version/s: PDB2.3.x Add Comment This message was sent by Atlassian JIRA (v6.3.15#6346-sha1:dbc023d) -- You received this message because you are subscribed to the Google Groups Puppet Bugs group. To unsubscribe from this group and stop receiving emails from it, send an email to puppet-bugs+unsubscr...@googlegroups.com. To post to this group, send email to puppet-bugs@googlegroups.com. Visit this group at http://groups.google.com/group/puppet-bugs. For more options, visit https://groups.google.com/d/optout.
Jira (PDB-1263) Round robin support for EC2 subnets
Title: Message Title Wyatt Alt commented on PDB-1263 Re: Round robin support for EC2 subnets I'm removing 2.3.x as a fix version here. I'll add it back in a bit later. Add Comment This message was sent by Atlassian JIRA (v6.3.15#6346-sha1:dbc023d) -- You received this message because you are subscribed to the Google Groups Puppet Bugs group. To unsubscribe from this group and stop receiving emails from it, send an email to puppet-bugs+unsubscr...@googlegroups.com. To post to this group, send email to puppet-bugs@googlegroups.com. Visit this group at http://groups.google.com/group/puppet-bugs. For more options, visit https://groups.google.com/d/optout.
Jira (PDB-1263) Round robin support for EC2 subnets
Title: Message Title Wyatt Alt updated an issue PuppetDB / PDB-1263 Round robin support for EC2 subnets Change By: Wyatt Alt Fix Version/s: PDB2.3.x Add Comment This message was sent by Atlassian JIRA (v6.3.15#6346-sha1:dbc023d) -- You received this message because you are subscribed to the Google Groups Puppet Bugs group. To unsubscribe from this group and stop receiving emails from it, send an email to puppet-bugs+unsubscr...@googlegroups.com. To post to this group, send email to puppet-bugs@googlegroups.com. Visit this group at http://groups.google.com/group/puppet-bugs. For more options, visit https://groups.google.com/d/optout.
Jira (FACT-628) facter returns incorrect value for `facter virtual` for Ldoms due to how the fact is added in Solaris.
Title: Message Title Eric Sorenson commented on FACT-628 Re: facter returns incorrect value for `facter virtual` for Ldoms due to how the fact is added in Solaris. Kylo Ginsberg this came up again as a customer escalation, could you pull it in for an upcoming sprint to have someone investigate? Add Comment This message was sent by Atlassian JIRA (v6.3.15#6346-sha1:dbc023d) -- You received this message because you are subscribed to the Google Groups Puppet Bugs group. To unsubscribe from this group and stop receiving emails from it, send an email to puppet-bugs+unsubscr...@googlegroups.com. To post to this group, send email to puppet-bugs@googlegroups.com. Visit this group at http://groups.google.com/group/puppet-bugs. For more options, visit https://groups.google.com/d/optout.
Jira (PUP-4329) Filebucket fails to update file resource if checksum doesn't match the configured checksum type
Title: Message Title Eli Young commented on PUP-4329 Re: Filebucket fails to update file resource if checksum doesn't match the configured checksum type One possible, albeit probably not ideal, answer to that problem would be to have the filebucket server calculate all supported hashes for files. Add Comment This message was sent by Atlassian JIRA (v6.3.15#6346-sha1:dbc023d) -- You received this message because you are subscribed to the Google Groups Puppet Bugs group. To unsubscribe from this group and stop receiving emails from it, send an email to puppet-bugs+unsubscr...@googlegroups.com. To post to this group, send email to puppet-bugs@googlegroups.com. Visit this group at http://groups.google.com/group/puppet-bugs. For more options, visit https://groups.google.com/d/optout.
Jira (PUP-4532) Enable passenger testing in aardwolf
Title: Message Title Josh Cooper commented on PUP-4532 Re: Enable passenger testing in aardwolf Blocked until we tag puppet 4.1.0 Add Comment This message was sent by Atlassian JIRA (v6.3.15#6346-sha1:dbc023d) -- You received this message because you are subscribed to the Google Groups Puppet Bugs group. To unsubscribe from this group and stop receiving emails from it, send an email to puppet-bugs+unsubscr...@googlegroups.com. To post to this group, send email to puppet-bugs@googlegroups.com. Visit this group at http://groups.google.com/group/puppet-bugs. For more options, visit https://groups.google.com/d/optout.
Jira (PDB-949) Retrieving facts that have had 'trusted' facts injected into them causes a 400 Attempt to assign to a reserved variable name: 'trusted' on node failure during Puppet catalog compilati
Title: Message Title Charlie Sharpsteen commented on PDB-949 Re: Retrieving facts that have had 'trusted' facts injected into them causes a 400 Attempt to assign to a reserved variable name: 'trusted' on node failure during Puppet catalog compilation. Kenneth Barber and I had a chat this morning and concluded that there are at least two cases in play here: It appears that for some agent catalog requests, the master is choosing to disregard the fact data provided by the agent and is instead falling back to cached facts or historic facts provided by PuppetDB. This is a Puppet bug if we have an authenticated agent requesting a catalog, we should always use the data provided by that agent. Caches and PuppetDB shouldn't be overriding this part of the transaction. For usecases which intentionally compile catalogs using historic data, such as puppet master compile and Catalog Preview, there is an issue with the trusted data being merged into the facts dataset. The compiler requires a Node object as input which has facts and trusted as separate datasets they cannot be merged. The first case with agent checkins has to be addressed on the Puppet side PuppetDB has no involvement with the processes that are misbehaving. There are two options for addressing the second case: The application, puppet master --compile, can munge Node objects retrieved from the indirector to ensure trusted data is removed from factsets and possibly re-added as trusted_data. This is currently the approach taken by Catalog Preview. The PuppetDB Node terminus can handle removing trusted data from factsets and possibly re-adding it as trusted_data. This would ensure the Node objects returned by the terminus store trusted data in the node.trusted_data attribute instead of having it mixed into the node.parameters attribute. I think the second option may be the best as it centralizes the handling of trusted data stored in PuppetDB and enables the node terminus to produce objects that can be passed directly to the compiler without further munging. The remaining question is whether we should re-add historical trusted data as 'trusted' or alter it in some way to indicate that the content is not tied to a current node request. Add Comment
Jira (PUP-4532) Enable passenger testing in aardwolf
Title: Message Title Kylo Ginsberg updated an issue Puppet / PUP-4532 Enable passenger testing in aardwolf Change By: Kylo Ginsberg Sprint: Client2015- 06 05 - 10 27 Add Comment This message was sent by Atlassian JIRA (v6.3.15#6346-sha1:dbc023d) -- You received this message because you are subscribed to the Google Groups Puppet Bugs group. To unsubscribe from this group and stop receiving emails from it, send an email to puppet-bugs+unsubscr...@googlegroups.com. To post to this group, send email to puppet-bugs@googlegroups.com. Visit this group at http://groups.google.com/group/puppet-bugs. For more options, visit https://groups.google.com/d/optout.
Jira (PUP-4050) Acceptance suite and install.rb use incorrect paths on Windows for codedir
Title: Message Title Steve Barlow updated an issue Puppet / PUP-4050 Acceptance suite and install.rb use incorrect paths on Windows for codedir Change By: Steve Barlow Sprint: Windows2015-03-11,Windows2015-03-25,Windows2015-04-08,Windows2015-04-22,Windows2015-05-06,Windows2015- 05 06 - 20 03 Add Comment This message was sent by Atlassian JIRA (v6.3.15#6346-sha1:dbc023d) -- You received this message because you are subscribed to the Google Groups Puppet Bugs group. To unsubscribe from this group and stop receiving emails from it, send an email to puppet-bugs+unsubscr...@googlegroups.com. To post to this group, send email to puppet-bugs@googlegroups.com. Visit this group at http://groups.google.com/group/puppet-bugs. For more options, visit https://groups.google.com/d/optout.
Jira (PDB-1300) Make acceptance tests compatible with Puppet 4.0
Title: Message Title Wyatt Alt updated an issue PuppetDB / PDB-1300 Make acceptance tests compatible with Puppet 4.0 Change By: Wyatt Alt Fix Version/s: PDB2.3.x Add Comment This message was sent by Atlassian JIRA (v6.3.15#6346-sha1:dbc023d) -- You received this message because you are subscribed to the Google Groups Puppet Bugs group. To unsubscribe from this group and stop receiving emails from it, send an email to puppet-bugs+unsubscr...@googlegroups.com. To post to this group, send email to puppet-bugs@googlegroups.com. Visit this group at http://groups.google.com/group/puppet-bugs. For more options, visit https://groups.google.com/d/optout.
Jira (PDB-1450) Make automatic expiration work with sync
Title: Message Title Russell Mull assigned an issue to Russell Mull PuppetDB / PDB-1450 Make automatic expiration work with sync Change By: Russell Mull Assignee: RussellMull Add Comment This message was sent by Atlassian JIRA (v6.3.15#6346-sha1:dbc023d) -- You received this message because you are subscribed to the Google Groups Puppet Bugs group. To unsubscribe from this group and stop receiving emails from it, send an email to puppet-bugs+unsubscr...@googlegroups.com. To post to this group, send email to puppet-bugs@googlegroups.com. Visit this group at http://groups.google.com/group/puppet-bugs. For more options, visit https://groups.google.com/d/optout.
Jira (PUP-4501) TypeCalculator instance_of? does not consider String type values.
Title: Message Title Henrik Lindberg commented on PUP-4501 Re: TypeCalculator instance_of? does not consider String type values. The type_of function is in stdlib, but may move to core puppet. Add Comment This message was sent by Atlassian JIRA (v6.3.15#6346-sha1:dbc023d) -- You received this message because you are subscribed to the Google Groups Puppet Bugs group. To unsubscribe from this group and stop receiving emails from it, send an email to puppet-bugs+unsubscr...@googlegroups.com. To post to this group, send email to puppet-bugs@googlegroups.com. Visit this group at http://groups.google.com/group/puppet-bugs. For more options, visit https://groups.google.com/d/optout.
Jira (PUP-4511) Types Array[?], Hash[?,?], and Optional[?] are not assignable to themselves
Title: Message Title Thomas Hallgren commented on PUP-4511 Re: Types Array[?], Hash[?,?], and Optional[?] are not assignable to themselves I tried this and it's actually not possible to reproduce from Puppet. The parser converts Array to Array[Data], Hash to Hash[Scalar,Data] and Optional to Optional[Undef] so the problem with missing contained types never surfaces in Puppet. It can only occur when the types are created from Ruby. Add Comment This message was sent by Atlassian JIRA (v6.3.15#6346-sha1:dbc023d) -- You received this message because you are subscribed to the Google Groups Puppet Bugs group. To unsubscribe from this group and stop receiving emails from it, send an email to puppet-bugs+unsubscr...@googlegroups.com. To post to this group, send email to puppet-bugs@googlegroups.com. Visit this group at http://groups.google.com/group/puppet-bugs. For more options, visit https://groups.google.com/d/optout.
Jira (PDB-1448) 'replace facts' failing due to foreign key constraint issue
Title: Message Title Wyatt Alt updated an issue PuppetDB / PDB-1448 'replace facts' failing due to foreign key constraint issue Change By: Wyatt Alt Fix Version/s: PDB2.3.x Add Comment This message was sent by Atlassian JIRA (v6.3.15#6346-sha1:dbc023d) -- You received this message because you are subscribed to the Google Groups Puppet Bugs group. To unsubscribe from this group and stop receiving emails from it, send an email to puppet-bugs+unsubscr...@googlegroups.com. To post to this group, send email to puppet-bugs@googlegroups.com. Visit this group at http://groups.google.com/group/puppet-bugs. For more options, visit https://groups.google.com/d/optout.
Jira (PDB-1439) PR (1356): (maint) Bump to latest trapperkeeper/jetty9/kitchensink - kbarber
Title: Message Title Wyatt Alt updated an issue PuppetDB / PDB-1439 PR (1356): (maint) Bump to latest trapperkeeper/jetty9/kitchensink - kbarber Change By: Wyatt Alt Fix Version/s: PDB3.0.0 Add Comment This message was sent by Atlassian JIRA (v6.3.15#6346-sha1:dbc023d) -- You received this message because you are subscribed to the Google Groups Puppet Bugs group. To unsubscribe from this group and stop receiving emails from it, send an email to puppet-bugs+unsubscr...@googlegroups.com. To post to this group, send email to puppet-bugs@googlegroups.com. Visit this group at http://groups.google.com/group/puppet-bugs. For more options, visit https://groups.google.com/d/optout.
Jira (PUP-4466) add acceptance: ensure functions can be written/execute in puppet language
Title: Message Title Eric Thompson assigned an issue to Kurt Wall Puppet / PUP-4466 add acceptance: ensure functions can be written/execute in puppet language Change By: Eric Thompson Assignee: EricThompson KurtWall Add Comment This message was sent by Atlassian JIRA (v6.3.15#6346-sha1:dbc023d) -- You received this message because you are subscribed to the Google Groups Puppet Bugs group. To unsubscribe from this group and stop receiving emails from it, send an email to puppet-bugs+unsubscr...@googlegroups.com. To post to this group, send email to puppet-bugs@googlegroups.com. Visit this group at http://groups.google.com/group/puppet-bugs. For more options, visit https://groups.google.com/d/optout.
Jira (PUP-1931) mount provider improvement when options property is not specified
Title: Message Title Melissa Stone updated an issue Puppet / PUP-1931 mount provider improvement when options property is not specified Change By: Melissa Stone Release Notes: NewFeature BugFix Add Comment This message was sent by Atlassian JIRA (v6.3.15#6346-sha1:dbc023d) -- You received this message because you are subscribed to the Google Groups Puppet Bugs group. To unsubscribe from this group and stop receiving emails from it, send an email to puppet-bugs+unsubscr...@googlegroups.com. To post to this group, send email to puppet-bugs@googlegroups.com. Visit this group at http://groups.google.com/group/puppet-bugs. For more options, visit https://groups.google.com/d/optout.
Jira (PUP-3812) Modify file_bucket_file API to use application/octet-stream instead of text/plain for Content-Type
Title: Message Title Erik Dasher commented on PUP-3812 Re: Modify file_bucket_file API to use application/octet-stream instead of text/plain for Content-Type It sounds like this doesn't reproduce. Nate Wolfe I'm throwing this at you. If you find a way to reproduce, please ping me because I want to ensure we get an automated test. Else, I think we should close it. Add Comment This message was sent by Atlassian JIRA (v6.3.15#6346-sha1:dbc023d) -- You received this message because you are subscribed to the Google Groups Puppet Bugs group. To unsubscribe from this group and stop receiving emails from it, send an email to puppet-bugs+unsubscr...@googlegroups.com. To post to this group, send email to puppet-bugs@googlegroups.com. Visit this group at http://groups.google.com/group/puppet-bugs. For more options, visit https://groups.google.com/d/optout.
Jira (PDB-1486) Rename /pe /sync endpoints to something more puppetdb specific
Title: Message Title Ryan Senior updated an issue PuppetDB / PDB-1486 Rename /pe /sync endpoints to something more puppetdb specific Change By: Ryan Senior Story Points: 2 Add Comment This message was sent by Atlassian JIRA (v6.3.15#6346-sha1:dbc023d) -- You received this message because you are subscribed to the Google Groups Puppet Bugs group. To unsubscribe from this group and stop receiving emails from it, send an email to puppet-bugs+unsubscr...@googlegroups.com. To post to this group, send email to puppet-bugs@googlegroups.com. Visit this group at http://groups.google.com/group/puppet-bugs. For more options, visit https://groups.google.com/d/optout.