klahoma City, OK 73104-5419
> Office: 405-271-8300 Lab: 405-271-8312
>
> Websites:
> Faculty page:
> https://basicsciences.ouhsc.edu/bmb/Faculty/bio_details/mooers-blaine-hm-phd
> BSC-OKC
> <https://basicsciences.ouhsc.edu/bmb/Faculty/bio_details/mooers-blaine-hm-phdBSC-OKC>
> (LBS
Hello Guys,
I am trying to extract the interference residue from a given protein PDB. I
have a protein named 1ak4 which has two chain A and B.
I open pymol, then go to file, the run the script from here
https://pymolwiki.org/index.php/InterfaceResidues#Simple_Example
Then I run the following
y
>
>
>
>
>
> Regards
>
>
>
> John
>
>
>
> *From:* Mohammad Goodarzi [mailto:mohammad.goda...@gmail.com]
> *Sent:* 08 August 2018 16:13
> *To:* pymol-users@lists.sourceforge.net
> *Subject:* [PyMOL] Color change of different domain
>
I have a protein in PDB called "3E9D"
I first get the seqeuence then I go here
https://www.ncbi.nlm.nih.gov/Structure/cdd/wrpsb.cgi
and I find the domains. Now I am trying to change the color accordingly
Now I am trying to change the color of each domain with different color
first I change the
> Kevin Jude, PhD
> Structural Biology Research Specialist, Garcia Lab
> Howard Hughes Medical Institute
> Stanford University School of Medicine
> Beckman B177, 279 Campus Drive, Stanford CA 94305
> Phone: (650) 723-6431
>
> On Wed, Aug 1, 2018 at 8:03 AM Mohammad Goodarzi
Hello,
I have a protein that i get from PDB https://www.rcsb.org/structure/2J3S
then I try to remove the chain B, and all water etc except the chain A.
it causes that I miss some atoms on the SER. Can you please advise how to
deal with it?
Thanks
Mohammad
Hello,
I would like to know how to check for missing or broken part of a PDB file
using pymol?
should i screen within each amino acid or there is a way to show it by
pymol?
Thanks
Mohammad
--
Check out the vibrant tech
Hello,
How can one plot specific mutation of TP53?
I want to show the differences
Thanks
--
Check out the vibrant tech community on one of the world's most
engaging tech sites, Slashdot.org!
Hi ,
I am trying to generate random sequences for a given region in order to run
Gromacs
This is the sequence of my protein
MEEKLKKTKIIFVVGGPGSGKGTQCEKIVQKYGYTHLSTGDLLRSEVSSGSARGKKLSEI
MEKGQLVPLETVLDMLRDAMVAKVNTSKGFLIDGYPREVQQGEEFERRIGQPTLLLYVDA
Mohammad -
>
> If you know the residue numbers at the domain boundaries, you can do this
> at the command line with, e.g.:
>
> color red, chain A and resi 1-100
> color cyan, chain A and resi 101-200
> etc.
>
> Hope that helps.
>
> Cheers,
> Jared
>
>
>
Hello,
I have a sequence and I obtain various domains. I want to show them with
various colors.
How can one do that? for example can one of you show it on SIRT1
Thanks
Mohammad
--
Check out the vibrant tech community on
and you are interested in one
> with the unique residue name "LIG":
>
> centerofmass resn LIG
>
> I wound't call that "finding" a pocket though.
>
> Cheers,
> Thomas
>
> > On Jul 11, 2017, at 7:42 PM, Mohammad Goodarzi <
> mohammad.goda...@gmail.co
Hello,
I am wondering whether it is possible to find the pocket of a protein in
Pymol?
lets say I have a protein and a ligand inside the pocket. I want to
estimate the x, y and z
Best Regards,
Mohammad
--
Check out the
Hello,
I want to know how to delete chain B and all ligands except the one
that I
want ?
Is there any way to know all molecules which comes with a PDB and then
remove those that you dont want?
Thanks
Mohammad
14 matches
Mail list logo