Good day,
It might be useful to readers to have a comparison table (ticks and crosses) in
the MultiAssayExperiment vignette that compares the features available in it to
those available in SummarizedExperiment, to allow quicker decision making.
--
Dario
Hi Anusha,
On Wed, Oct 18, 2017 at 2:30 PM, Anusha Nagari <
anusha.nag...@utsouthwestern.edu> wrote:
>
> Can you please let me know how to go about the following NOTE. Or if this
is something that should be really taken care of for a successful package
build and install:
>
> * checking
> Sounds great; please make a pull request against
>
> https://github.com/Bioconductor/Rsamtools
I will send a pull request tomorrow. I will probably have some technical
questions on testing and may ask you there on github. Thanks for the quick
response.
Heng
> On Oct 18, 2017, at 16:40,
On 10/18/2017 04:32 PM, Heng Li wrote:
Hi,
I am not sure whether I should send the request to this mailing list in this
case, but I am not sure what is the best place to ask.
Anyway, an alignment with >65535 operators can't be encoded in the current BAM
format. Unfortunately, a tiny fraction
Hi,
I am not sure whether I should send the request to this mailing list in this
case, but I am not sure what is the best place to ask.
Anyway, an alignment with >65535 operators can't be encoded in the current BAM
format. Unfortunately, a tiny fraction of ultra-long nanopore reads will be
>
> On Wed, Oct 18, 2017 at 10:26 AM, Ryan Thompson
> wrote:
>
>> I think the main reason for reusing/subclassing core classes that users
>> can
>> appreciate is that it makes it much easier for users to integrate multiple
>> packages into a single workflow. Only the most
Hi Herve,
Thank you for your response.
>In other words putting everything in Imports can hurt
>usability/friendliness. The approach should be more nuanced. It's
>good that the 'R CMD check' NOTE reminds us about the Depends vs
>Imports trade-off but for Bioconductor packages the choices made
>by
Martin, Suharto, et al.,
On Wed, Oct 18, 2017 at 9:54 AM, Martin Maechler wrote:
> **
>
> > Note: In theory, if function 'factor' merged duplicated 'labels' in
> all cases, at least in
> > factor(c(sqrt(2)^2, 2)) ,
> > function 'factor' could do
Good points. I think Levi hit on the direct reuse argument (via inheritance
and composition), and, you're right, interoperability is another big one.
On Wed, Oct 18, 2017 at 10:26 AM, Ryan Thompson
wrote:
> I think the main reason for reusing/subclassing core classes that
Hi,
On 10/18/2017 09:19 AM, Pariksheet Nanda wrote:
Hi Anusha
On Wed, Oct 18, 2017 at 12:04 PM, Anusha Nagari
wrote:
Depends: includes the non-default packages:
‘MASS’ ‘parallel’ ‘S4Vectors’ ‘IRanges’ ‘GenomeInfoDb’
‘GenomicRanges’ ‘GenomicAlignments’
I think the main reason for reusing/subclassing core classes that users can
appreciate is that it makes it much easier for users to integrate multiple
packages into a single workflow. Only the most basic of pipelines uses just
a single Bioconductor package. For instance, an "edgeR" pipeline
> Suharto Anggono Suharto Anggono via R-devel
> on Sun, 15 Oct 2017 16:03:48 + writes:
> In R devel, function 'factor' has been changed, allowing and merging
duplicated 'labels'.
Indeed. That had been asked for and discussed a bit on this
list from
Hi Anusha
On Wed, Oct 18, 2017 at 12:04 PM, Anusha Nagari
wrote:
>
> Depends: includes the non-default packages:
> ‘MASS’ ‘parallel’ ‘S4Vectors’ ‘IRanges’ ‘GenomeInfoDb’
> ‘GenomicRanges’ ‘GenomicAlignments’ ‘rtracklayer’
> Adding so many packages to the
> Martin Maechler
> on Mon, 16 Oct 2017 19:13:31 +0200 writes:
> Stephen Berman
> on Sun, 15 Oct 2017 01:53:12 +0200 writes:
> > (I reported the test failure mentioned below to R-help but was advised
> > that
Hi every one
I am Mohammed OE the maintainer of cellbaseR package.
I am getting this error while trying to push a bug fix to RELEASE branch
remote: FATAL: W refs/heads/RELEASE_3_5 packages/cellbaseR m.abdallah
DENIED by fallthru
remote: error: hook declined to update refs/heads/RELEASE_3_5
To
Hi,
I just modified the Sequence Data workflow to suggest the
use of readDNAStringSet() and family to read in a FASTA file.
Cheers,
H.
On 10/18/2017 08:03 AM, Martin Morgan wrote:
On 10/18/2017 01:00 AM, Dario Strbenac wrote:
Good day,
If I have a FASTA file that contains
On 10/18/2017 01:00 AM, Dario Strbenac wrote:
Good day,
If I have a FASTA file that contains
sp|Q9NYW0|T2R10_HUMAN Taste receptor type 2 member 10 OS=Homo sapiens
GN=TAS2R10 PE=1 SV=3
MLRVVEGIFIFVVVSESVFGVLGNGFIGLVNCIDCAKNKLSTIGFILTGLAISRIFLIWI
The binary tree algorithm does not need additional scrambling. I have
written the R code for the algorithm in the last answer at:
https://stackoverflow.com/questions/311703/algorithm-for-sampling-without-replacement/46807110#46807110
However, the algorithm will probably be outperformed by hash
Thank you for your answer. Certainly, hash table must be faster than
binary tree.
__
R-devel@r-project.org mailing list
https://stat.ethz.ch/mailman/listinfo/r-devel
Splus used a similar method for sampling from "bigdata" objects. One
problem was that sample() is used both for creating a sample and for
scrambling the order of a vector. Scrambling the order of a big vector
wastes time. It would be nice to be able to tell sample() that we don't
care about the
> From: "Pavel S. Ruzankin"
> Let us consider the current uniform sampling without replacement
> algorithm. It resides in function do_sample in
> https://svn.r-project.org/R/trunk/src/main/random.c
> Its complexity is obviously O(n), where the sample is selected from
>
See also:
P. Gupta, G. P. Bhattacharjee. (1984) An efficient algorithm for random
sampling without replacement. International Journal of Computer
Mathematics 16:4, pages 201-209.
http://dx.doi.org/10.1080/00207168408803438
Teuhola, J. and Nevalainen, O. 1982. Two efficient algorithms for random
Hi Kylie,
I have reset your package to its original state. The best way to proceed is
with this documentation,
http://master.bioconductor.org/developers/how-to/git/sync-existing-repositories/
You specifically want to take a look at point#8
Thank you very much!
Best,
Sam
On Oct 17, 2017, at 9:58 PM, Obenchain, Valerie
>
wrote:
Yes, if all is green on the build report you can ignore it.
Thanks.
Valerie
On 10/17/2017 11:46 AM, Samuel E Zimmerman wrote:
Hi Matthew,
I’ve reset your package to the original clean state. Same place we were last
time when this happened.
I encourage you to ask questions on bioc-devel if you are not sure about a
certain command, or are facing problems.
Best,
Nitesh
> On Oct 13, 2017, at 3:31 PM, Turaga, Nitesh
We process the keys manually at noon EST every business day.
You submitted at 17/10/2017 21:54:46 . Please wait.
Best,
Nitesh
> On Oct 17, 2017, at 11:33 PM, Yang Liao wrote:
>
> Dear Bioconductor maintainers,
>
>
> I'm the co-maintainer of the Rsubread package. When
Hello,
I’ve tried to have a wrapper function of seq.Date(), saying seq_date(). The
seq_date() function takes exactly the same arguments and the defaults as
seq.Date(). The seq_date() is expected to return the same results as
seq.Date(), but it triggers an error in seq.Date(). The little
If somebody is interested I can write the code. But somebody else has to
add the code for handling int / long int / double cases, since I do not
have enough experience in that.
__
R-devel@r-project.org mailing list
28 matches
Mail list logo