[R] Fw: Problems with old version of R

On Wed, 22 Apr 2009 11:18:17 -0400 Dimitri Liakhovitski ld7...@gmail.com wrote: DL You don't have to uninstall the old version. Just install the new DL version. What I do then - I manually copy (in Windows Explorer) all DL the packages from the folder library that is under your old R DL version

[R] question of plm package

Dear R help, I use the package plm the function plm() to analyse a panel data and estimate a fixeffect model. I use the code as follow : fe - plm(y~x+z, data, model = within) I want to use bootstrap to estimate standard error I consult the paper plm.pdf , but I can't

Re: [R] Problems with old version of R

On Wed, 22 Apr 2009 11:18:17 -0400 Dimitri Liakhovitski ld7...@gmail.com wrote: DL You don't have to uninstall the old version. Just install the new DL version. What I do then - I manually copy (in Windows Explorer) all DL the packages from the folder library that is under your old R DL version

Re: [R] Double/Triple seasonal holt winter using R

Dear Members, Please find the attached paper by taylor which I mentioned below. SAS handles multiple seasonality as follows: http://support.sas.com/rnd/app/ets/proc/ets_forecast.html Is there any package in R which can handle month, week and day-of-the week seasonality all together to predict

Re: [R] Discover significant change in sorted vector

Hi One possibility is to use segmented e.g a - c(2,3,3,5,6,8,8,9,15, 25, 34,36,36,38,41,43,44,44,46) ix - seq_along(a) plot(ix,a) library(segmented) fit-lm(a~ix) fit.s-segmented(fit, ~ix, list(ix=c(5,10))) fit.s Call: segmented.lm(obj = fit, seg.Z = ~ix, psi = list(ix = c(5, 10)))

Re: [R] large factorials

J Dougherty wrote: On Wednesday 22 April 2009 12:21:41 pm molinar wrote: I am working on a project that requires me to do very large factorial evaluations. On R the built in factorial function and the one I created both are not able to do factorials over 170. The first gives an error and

Re: [R] ggplot2/aesthetic plotting advice

Dear Ben, With a lot of overlapping errorbar things will always look cluttered. Below you will find a few suggestions. HTH, Thierry library(ggplot2) nx - 3 ngrp - 5 nper - 4 x - rep(1:nx,ngrp*nper) y - runif(nx*ngrp*nper) g - factor(rep(1:ngrp,each=nx*nper)) dat - data.frame(Year =

Re: [R] Count Code

Many thanks for this, I will try this code. Much appreciated. -Original Message- From: Peter Dalgaard [mailto:p.dalga...@biostat.ku.dk] Sent: 22 April 2009 22:05 To: David Winsemius Cc: Bronagh Grimes; r-help@r-project.org Subject: Re: [R] Count Code David Winsemius wrote: On Apr

Re: [R] function output with for loop and if statement

On Wed, 2009-04-22 at 15:51 -0400, aaron wells wrote: Hello all, turns out i'm having a bad R week. I am at my wits end with a function that I am trying to write. When I run the lines of code outside of a function, I get the desired output. When I wrap the lines of code into a function it

Re: [R] function output with for loop and if statement

On Wed, 2009-04-22 at 16:51 -0400, aaron wells wrote: Mark, thanks for the suggestions. Unfortunately that did not fix the problem. I have experimented (with no success) with placing braces in different locations around the if/else statements and removing them all together. Then your

Re: [R] plot confidence intervals as shaded band

Perhaps you'll be interested in denstrip package : http://cran.r-project.org/web/packages/denstrip/index.html Examples : http://www.mrc-bsu.cam.ac.uk/personal/chris/papers/denstrip.pdf 2009/4/22 BARRES-DE-ALMEIDA U. u.b.alme...@durham.ac.uk Hi, does anyone know how do I plot confidence

[R] Running Scripting on Linux Machine

Hi all, I am new to using R on a Linux machine I have a few questions on set-up. If anyone has experience in this area any advice would be greatly appreciated. - When I open R I have the option to do the following: o 'Run in Terminal' o 'Display' o 'Cancel' o 'Run'

Re: [R] large factorials

vQ if you really really need to have it done from within r, vQ you may want to use an external facility such as bc, the vQ 'basic calculator' [1,2]. for example, use the vQ (experimental!) r-bc: vQ source('http://r-bc.googlecode.com/svn/trunk/R/bc.R') vQ (you can

Re: [R] Discover significant change in sorted vector

dear Hans, As pointed out by Petr Pikal, segmented allows to estimate breakpoints of (continuous) piecewise relationships. That is, the mean lines are assumed to be connected and segmented tries to join them at the estimated breakpoints. The estimated breakpoints may be any value in the range

Re: [R] Running Scripting on Linux Machine

On Thu, 2009-04-23 at 09:31 +0100, Bronagh Grimes wrote: Hi all, I am new to using R on a Linux machine I have a few questions on set-up. If anyone has experience in this area any advice would be greatly appreciated. - When I open R I have the option to do the

[R] Creating a model.matrix with a logical data matrix

Hi, I'm trying to create a model.matrix (or use lm, which result in the same issue), using a logical data matrix. When I use a numerical matrix, I can do: numeric_mat-matrix(c(1,2,3,4),c(2,2)) model.matrix(~numeric_mat) and it works well. When I use logical matrix:

Re: [R] Running Scripting on Linux Machine

Gavin, This is great, thank you. I will have a look at downloading this now. Much appreciated, Bronagh -Original Message- From: Gavin Simpson [mailto:gavin.simp...@ucl.ac.uk] Sent: 23 April 2009 09:47 To: Bronagh Grimes Cc: r-help@r-project.org Subject: Re: [R] Running Scripting on

Re: [R] how to split and handle a big R program into multiple files

source() and the use of functions ... Javier --- I am working on a program totally written in R which is now getting bigger and bigger so that editling the only file that contains all the functions is becoming more and more unmanageable. I wonder whether it is possible to spread the R code,

Re: [R] how to split and handle a big R program into multiple files

If most of the functions are quite stable (you don't change them too often), you could also consider creating a R package with package.skeleton. baptiste On 23 Apr 2009, at 10:39, jgar...@ija.csic.es wrote: source() and the use of functions ... Javier --- I am working on a program

[R] R: how to split and handle a big R program into multiple files

Is that an R command ? I browswd for the on-line hlp about such a command but could not find it. Thank you. maura -Messaggio originale- Da: baptiste auguie [mailto:ba...@exeter.ac.uk] Inviato: gio 23/04/2009 11.48 A: mau...@alice.it Cc: r-help Help Oggetto: Re: [R] how to split and

[R] R: how to split and handle a big R program into multiple files

It looks like I can store each function in a different file and have main file containing the include-like directiives and the main instructions. Something like: source(Program_Global_Constants.R) source(Program_Global_Variables.R) source(Program_Fun1.R) source(Program_Fun2.R)

[R] Running Edit() or Fix() on Linux Machine

Hi all, As I am new to using R on a Linux machine I have another question if that's ok. I am trying to use the fix() or edit() function on this Linux machine but I get the following error message: Error in dataentry(datalist, modes) : invalid device In addition: Warning message: In

Re: [R] R: how to split and handle a big R program into multiple files

It is an R command (package utils), see ?package.skeleton baptiste On 23 Apr 2009, at 10:51, mau...@alice.it wrote: Is that an R command ? I browswd for the on-line hlp about such a command but could not find it. Thank you. maura -Messaggio originale- Da: baptiste auguie

[R] how to split and handle a big R program into multiple files

I am working on a program totally written in R which is now getting bigger and bigger so that editling the only file that contains all the functions is becoming more and more unmanageable. I wonder whether it is possible to spread the R code, making up the same program, in a number of smaller

Re: [R] plot confidence intervals as shaded band

BARRES-DE-ALMEIDA U. wrote: Hi, does anyone know how do I plot confidence intervals as a shaded band around a curve, rather than as errors bars? Hi Ulisses, The dispersion function in plotrix will draw lines rather than error bars, but there is as yet no fill option. I may have a look at

Re: [R] Running Scripting on Linux Machine

Hi Gavin, I downloaded ESS can now see a buffer named '*ESS*' in my EMACS script file. To start an ESS process I followed the notes in the documentation: 1. To start an S session on Unix or on Windows when you use the Cygwin bash shell, simply type M-x S RET. 2. S will then (by default) ask

[R] (no subject)

Dear Helen, bootstrapped standard errors are currently not supported in 'plm'. Cheers, Giovanni -- Original Message: Date: Wed, 22 Apr 2009 23:23:26 -0700 (PDT) From: Helen Chen 96258...@nccu.edu.tw Subject: [R] question of plm package To: r-help@r-project.org

[R] Aggregate Function

Hi all, I am currently carrying out the following aggregate function: D2 - with(D1,aggregate(COST, list(FRUIT, VEG),FUN=sum)) The function is working fine but I am getting sum output in the following format: 1.750623e+09 How can I re-format the output to look like 1750622640.7? Many thanks

[R] rbind on a list

I have two lists (and possibly more): col.prop - structure(list(B = structure(c(0.5, 0.5, 0.6, 0.4, 0.556, 0.444), class = c(cast_matrix, matrix), .Dim = 2:3, .Dimnames = list( NULL, NULL)), D = structure(c(1, 0, 0.667, 0.333, 0.8, 0.2), class =

Re: [R] Running Scripting on Linux Machine

On Thu, 2009-04-23 at 11:08 +0100, Bronagh Grimes wrote: Hi Gavin, I downloaded ESS can now see a buffer named '*ESS*' in my EMACS script file. To start an ESS process I followed the notes in the documentation: 1. To start an S session on Unix or on Windows when you use the Cygwin

Re: [R] large factorials

Also the R sympy package can handle this: library(rSymPy) Loading required package: rJava factorial.sympy - function(n) sympy(paste(factorial(, n, ))) # note that first time sympy is called it loads java, jython and sympy # but on subsequent calls its faster. So make a dummy call first.

Re: [R] Aggregate Function

Thanks a mil, will try that. -Original Message- From: Petr PIKAL [mailto:petr.pi...@precheza.cz] Sent: 23 April 2009 12:18 To: Bronagh Grimes Cc: r-help@r-project.org Subject: Odp: [R] Aggregate Function Try to set scipen in options. ?options e.g. options(scipen=12) Regards Petr

[R] Odp: Aggregate Function

Try to set scipen in options. ?options e.g. options(scipen=12) Regards Petr r-help-boun...@r-project.org napsal dne 23.04.2009 12:30:11: Hi all, I am currently carrying out the following aggregate function: D2 - with(D1,aggregate(COST, list(FRUIT, VEG),FUN=sum)) The function is

[R] R: R: how to split and handle a big R program into multiple files

I read the on-line documentation. What I am still missing is how I run my program after encapsulating it in a package. I will have to load the package ... just guessing Thank you maura -Messaggio originale- Da: baptiste auguie [mailto:ba...@exeter.ac.uk] Inviato: gio 23/04/2009 12.17 A:

Re: [R] Running Scripting on Linux Machine

Hi there, I am working in SLES / SLED 10. I use ALT+X then SHIFT+R? Many thanks, Bronagh -Original Message- From: Gavin Simpson [mailto:gavin.simp...@ucl.ac.uk] Sent: 23 April 2009 11:44 To: Bronagh Grimes Cc: r-help@r-project.org Subject: RE: [R] Running Scripting on Linux Machine

Re: [R] rbind on a list

Try this: lapply(names(col.prop), function(idx)rbind(col.prop[[idx]], n[[idx]])) On Thu, Apr 23, 2009 at 7:33 AM, David Hajage dhajag...@gmail.com wrote: I have two lists (and possibly more): col.prop - structure(list(B = structure(c(0.5, 0.5, 0.6, 0.4, 0.556,

[R] Accessing all the first sub-elements of a list of list

Hello, The 179th and 180th elements of my list of lists look like this: [[179]] [[179]]$desc [1] ipi|IPI00646510|IPI00646510.2 ISOFORM P60-HCK OF TYROSINE-PROTEIN KINASE HCK. [[179]]$seq [1] MGGRSSCEDPGCPRDEERAPRMGCMKSKFLQVGGNTFSKTETSASPHCPVYVPDPTSTIKPGPNSHNSNTP

[R] Two 3D cones in one graph

Dear R-users: The following code produces two cones in two panels. What I would like to have is to have them in one, and to meet in the origin. Does anyone have any good ideas how to do this? Thanks for your help Jaakko library(lattice) A-matrix(ncol=2, nrow=64) for(i in 0:63) {

[R] generate individual panel keys/legends in lattice barchart

Dear R users. I am wondering what is the simplest way is to generate individual keys for each panel in a lattice barchart? The help pages said: To use more than one legend, or to have arbitrary legends not constrained by the structure imposed by key, use the legend argument, but after trying

[R] problem loading ncdf library on MAC

Hi there, I'm more or less new to R and have just installed R on my MAC laptop. I managed to install everything easily enough (R version 2.9) and a few packages, but when I try to load the ncdf package (in R) I get the following error: library(ncdf) Error in dyn.load(file, DLLpath = DLLpath,

[R] Cox regression

Hi I am doing a survival analysis and have run into a couple of things that I was hoping I could get some advice on. The first thing is that when I run an ordinary Cox regression in R I get the same results that I do using Stata (provided that I specify the Efron method for handling ties) but

[R] Failing to print mer object in an RData image

Hi all I have problems in accessing a mer object called model.01 from a workspace that was created with R 2.8.1 and saved with save into an .RData file (on Windows XP or Ubuntu 8.10, don't remember anymore). Now I want to open it in R 2.9.0 on Ubuntu 8.10. I use # load workspace load(name.RData)

[R] the definition of eigenvector in R

Dear All i have a little puzzle about eigenvector in the R. As we know that the eigenvector can be displayed on several form. For example A=matrix(c(1,2,4,3),2,2) if we want to get the eigenvalue and eigenvector, the code followed eigen(A) $values [1] 5 -1 $vectors [,1] [,2]

Re: [R] Accessing all the first sub-elements of a list of list

Try this: lapply(l, '[', 'desc') On Thu, Apr 23, 2009 at 8:13 AM, Amelia Baud a...@sanger.ac.uk wrote: Hello, The 179th and 180th elements of my list of lists look like this: [[179]] [[179]]$desc [1] ipi|IPI00646510|IPI00646510.2 ISOFORM P60-HCK OF TYROSINE-PROTEIN KINASE HCK.

Re: [R] Returning Variables in R to Linux Shell

On 22 April 2009 at 11:42, Whit Armstrong wrote: | try littler: | | warmstr...@linuxsvr2:/tmp$ export MYVALUE=`r -e 'cat(10)'` | warmstr...@linuxsvr2:/tmp$ env|grep MYVALUE | MYVALUE=10 | warmstr...@linuxsvr2:/tmp$ Thanks to a suggestion by Paul Gilbert, littler supports the 'status' argument

Re: [R] the definition of eigenvector in R

On 4/23/2009 4:50 AM, Abelian wrote: Dear All i have a little puzzle about eigenvector in the R. As we know that the eigenvector can be displayed on several form. For example A=matrix(c(1,2,4,3),2,2) if we want to get the eigenvalue and eigenvector, the code followed eigen(A) $values [1] 5 -1

Re: [R] R: R: how to split and handle a big R program into multiple files

On 4/23/2009 7:15 AM, mau...@alice.it wrote: I read the on-line documentation. What I am still missing is how I run my program after encapsulating it in a package. I will have to load the package ... just guessing If I had a large program that I needed to run just once, e.g. an analysis or

Re: [R] rbind on a list

Thank you, it is working. David 2009/4/23 Henrique Dallazuanna www...@gmail.com Try this: lapply(names(col.prop), function(idx)rbind(col.prop[[idx]], n[[idx]])) On Thu, Apr 23, 2009 at 7:33 AM, David Hajage dhajag...@gmail.com wrote: I have two lists (and possibly more): col.prop -

[R] how to control significant digits(?) on axis labels

Dear R mailing list I would like some help on how to get R to display the same number of significant digits (?) for *all* tick marks on axis labels (yet be flexible enough to handle different data sets that vary by 10-1000X). Consider this simple example: #---# x -

Re: [R] Two 3D cones in one graph

Jaakko Nevalainen wrote: The following code produces two cones in two panels. What I would like to have is to have them in one, and to meet in the origin. Does anyone have any good ideas how to do this? Adapt the cone3d() function from the shapes3d demo in the rgl package? Ben

Re: [R] Running Scripting on Linux Machine

On Thu, 23 Apr 2009 09:31:54 +0100 Bronagh Grimes bronagh.gri...@distinct.ie wrote: BG - But the only way I can run this script is to call the BG whole script using the source() function. BG BG - Does anyone know how I can implement a script that I can BG run as in the Windows

[R] Nonlinear regression help

I seek help with nonlinear regression for my data. I've run intro trouble fitting a model to my data as follows: rate_parameter stable_population 75 1996.1277 100 1623.2979 125 1362.3475 150 1164.6738 175 1014.8227 200 892.0851 225 794.1844 250 710.1489 275 639.6738 300 578.0496 325

[R] R: R: R: how to split and handle a big R program into multiple files

Submitting to CRAN is one of my goals. What we are implementing is not done yet either in R or MatLab. There exists some Fortran applications of the algorithms we are implementing for general use. it'll still take me some time before I get there. Maura -Messaggio originale- Da:

Re: [R] Running Scripting on Linux Machine

On Thu, 2009-04-23 at 12:17 +0100, Bronagh Grimes wrote: Hi there, I am working in SLES / SLED 10. I use ALT+X then SHIFT+R? Yes, Alt == M (Meta) Alt-x R (upper case R) is what I use to start R. Alt-x S will try to start S-Plus (at least it does on my Linux box), which will fail if you

Re: [R] R: R: R: how to split and handle a big R program into multiple files

May I suggest you join R-forge when your package has taken shape? It'll allow you to easily check the building of the package on all platforms and you'll be able to submit to CRAN in one click when it's good enough. baptiste On 23 Apr 2009, at 13:58, mau...@alice.it wrote: Submitting to

[R] Setting lattice par parameters

Hello I'm plotting a large suite of barcharts and need to modify the size of the text for both the yaxis and xaxis labels. I've tried using the following: trellis.par.set(list(par.ylab.text = list(cex = 0.65)), trellis.par.set(list = par.xlab.text = list(cex = 0.65 On inspection,

[R] surface interpolating 3d

Hi all, When you want to draw a surface with a mathematics program you need of two vectors x and y and a matrix z. Then you plot the surface. For example: x=[1 2 3]; y=[5 6 7]; z=[1 2 3 4 5 6 7 8 9]; For my applications I have a 3 vectors x, y, z, that are the coordinates x, y, and z of

[R] R 2.9 binaries for redhat entreprise 4 / X86_64

Hi everybody. I'd like to ask if someone could tell me when the binaries for R 2.9 / redhat entreprise 4 / X86_64 will be available ? I don't need a precise date but some indication like 1 month, 6 month, never ? Thank you for any help. Mathieu --- Mathieu Van der Haegen Machine Learning

[R] argument 'exclude' in xtabs

Dear all I was willing to use argument 'exclude' in function xtabs to remove some levels of factors (xtabs help page says 'exclude: a vector of values to be excluded when forming the set of levels of the classifying factors). I tried: mydata - data.frame( + treatment = c(B, A, C, C, B,

[R] R 2.9 for redhat entreprise 4 / X86_64

Hi everybody. I'd like to ask if someone could tell me when the binaries for R 2.9 / redhat entreprise 4 / X86_64 will be available ? I don't need a precise date but some indication like 1 month, 6 month, never ? Thank you for any help. Mathieu --- Mathieu Van der Haegen Machine Learning

Re: [R] Setting lattice par parameters

Because you're not calling trellis.par.set correctly. It should be: trellis.par.set(par.ylab.text = list(cex = 0.65), par.xlab.text = list(cex = 0.65)) However, I usually do things like this: my.theme - list(par.ylab.text = list(cex = 0.65), par.xlab.text = list(cex = 0.65)) barchart(...,

Re: [R] large factorials

Here is what I did: library(rSymPy) factorial.sympy - function(n) sympy(paste(factorial(, n, ))) factorial.sympy(171) [1]

[R] R 2.9 binaries for redhat entreprise 4 / X86_64

On Thu, 23 Apr 2009, Mathieu Van der Haegen wrote: I'd like to ask if someone could tell me when the binaries for R 2.9 / redhat entreprise 4 / X86_64 will be available ? I don't need a precise date but some indication like 1 month, 6 month, never ? How about: Now, in Red Hat's RawHide

Re: [R] large factorials

Hi Samantha, It is quite likely that you are not doing something right when you are explicitly computing large factorials. There is probably a good asymptotic approximation that will simplify things for you. In my experience, there is seldom a need to explicitly compute factorials of integers.

Re: [R] Setting lattice par parameters

Sundar, Thank you very much. I see my mistake. Much appreciated. Steve Friedman Ph. D. Spatial Statistical Analyst Everglades and Dry Tortugas National Park 950 N Krome Ave (3rd Floor) Homestead, Florida 33034 steve_fried...@nps.gov Office (305) 224 - 4282 Fax (305) 224 - 4147

Re: [R] R 2.9 binaries for redhat entreprise 4 / X86_64

On Apr 23, 2009, at 8:18 AM, Mathieu Van der Haegen wrote: Hi everybody. I'd like to ask if someone could tell me when the binaries for R 2.9 / redhat entreprise 4 / X86_64 will be available ? I don't need a precise date but some indication like 1 month, 6 month, never ? Thank you for any

[R] Plots - several pages per pdf - quality/size issue

Dear R-experts, I hope that question will not be too redundant (sorry if it is) but i don't seem able to find the answer i need in the archives... I try to create a file which would have 1.several pages and 2.several plots by page. I know how to make a pdf file this way, but my problem is that

[R] Problem to get a simple Analysis of Variance table with lmer()

Dear R users, Is someone know how to get a simple analysis of variance table using other random distribution than normal (ex: Poisson or Binomial)? When I try, I recieved this message: (See my R code below) - R response Erreur dans

[R] transposing a matrix - row by row?

Hello, I have a matrix that is a product of tapply on a larger data set. Let's assume it looks like this: X-matrix(c(10,20,30,40,50,60),2,3) dimnames(X)-list(c(1,2),c(1,2,3)) (X) 1 2 3 1 10 30 50 2 20 40 60 Is there an efficient way of transforming this matrix into the following matrix:

[R] Plots - several pages per pdf - quality/size issue

Dear R-experts, I hope that question will not be too redundant (sorry if it is) but i don't seem able to find the answer i need in the archives... I try to create a file which would have 1.several pages and 2.several plots by page. I know how to make a pdf file this way, but my problem is

Re: [R] large factorials

sympy() returns a character string, not an R numeric -- it shouldn't automatically return an R numeric since R can't represent all the numbers that sympy can. The development version of rSymPy has a second class which produces objects of class c(Sym, character) and those can be manipulated with

Re: [R] transposing a matrix - row by row?

Dear Dimitri, Have a look at melt() from the reshape package. X-matrix(c(10,20,30,40,50,60),2,3) dimnames(X)-list(c(1,2),c(1,2,3)) library(reshape) melt(X) HTH, Thierry ir. Thierry Onkelinx Instituut voor natuur-

Re: [R] large factorials

The code in my prior post works (except one comment was wrong) but try this instead. The only change is the last line of the sum1 function. This way it produces a Sym object rather than a character string. library(rSymPy) # define factorial to return a Sym object factorial.Sym - function(n)

Re: [R] transposing a matrix - row by row?

one way is the following: X - matrix(c(10,20,30,40,50,60), 2, 3, dimnames = list(c(1,2), c(1,2,3))) tX - t(X) cbind( rows = c(col(tX)), columns = c(row(tX)), entries = c(tX) ) I hope it helps. Best, Dimitris Dimitri Liakhovitski wrote: Hello, I have a matrix that is a

[R] Adobe FLEX interacting with R for rich visualization over the Web

Hi R users, I am looking to create a rich internet application using R as the analytical back-end with a GUI written entirely in Adobe FLEX. I have come across this paper http://www.bioconductor.org/packages/2.3/bioc/vignettes/RWebServices/inst/doc/RelatedWork.pdf which provides relevant

Re: [R] transposing a matrix - row by row?

Thank you very much, Thierry! Really amazing, the magic melt from reshape. And, in fact, a bit dangerous - it just do what I need without any efforts on my part! Dimitri On Thu, Apr 23, 2009 at 10:40 AM, ONKELINX, Thierry thierry.onkel...@inbo.be wrote: Dear Dimitri, Have a look at melt() from

Re: [R] Plots - several pages per pdf - quality/size issue

I hope that question will not be too redundant (sorry if it is) but i don't seem able to find the answer i need in the archives... I try to create a file which would have 1.several pages and 2. several plots by page. I know how to make a pdf file this way, but my problem is that the pdf

Re: [R] large factorials

One more improvement. Perhaps it would be best just to return a numeric so sum1 inputs and outputs numerics: library(rSymPy) # define factorial to return a Sym object factorial.Sym - function(n) Sym(factorial(, n, )) sum1 - function(l,u,t,i,n,w) { v - 0 for (m in 0 :w) { v1 -

Re: [R] Adobe FLEX interacting with R for rich visualization over the Web

Harsh wrote on 04/23/2009 09:49 AM: Hi R users, I am looking to create a rich internet application using R as the analytical back-end with a GUI written entirely in Adobe FLEX. I have come across this paper

Re: [R] R 2.9 binaries for redhat entreprise 4 / X86_64

Hi ! Thank you for the info. Is this a little bit stable ? Mathieu On 23 Apr 2009, at 16:01, R P Herrold wrote: On Thu, 23 Apr 2009, Mathieu Van der Haegen wrote: I'd like to ask if someone could tell me when the binaries for R 2.9 / redhat entreprise 4 / X86_64 will be available ? I

[R] boxplot of two variables

Hello ! I have a dataframe with 6 variables (A1,A2,B1,B2,C1,C2) and 1 factor (F). I would like to produce a graph consisting of 3 boxplots sets, one for every two variables (i.e A1 A2) by the factor (F). I was looking around and I cannot figure it out, any suggestions? Best Regards,

Re: [R] R-User groups in North America (SF, LA, NYC, Ottawa)

Folks, Here is the correct URL for the NYC R Users group: New York City http://www.meetup.com/nyhackr (61 members) Organized by Joshua Reich josh at i2pi com (Thanks to Johnathan Boysielal for pointing out this error, and Curt for the OSU correction as well). On Wed, Apr 22, 2009 at 12:01

[R] Course announcement: R for Financial Data Analysis in New York (July 16-18th)

Dear userRs, Mango Solutions are pleased to announce that we will deliver a 3-day introductory R course focused on financial analysis in New York on the 16-18th of July. The course topics are as follows: * Introduction * The R Environment * Data Objects * Functions

Re: [R] boxplot of two variables

Check out ggplot2: http://had.co.nz/ggplot2 especially: http://had.co.nz/ggplot2/geom_boxplot.html But you are strongly advised to read the book: http://had.co.nz/ggplot2/book/ On Thu, Apr 23, 2009 at 12:13 PM, Gabriel R. Rodriguez garo...@cnia.inta.gov.ar wrote: Hello ! I have a

[R] power.t.test formula

Hi, Does anyone of you knows a reference for the formula used in power.t.test function? And also why it uses the Student's distribution instead of Normal. (I know both of them can be used but don't see whether choose one or the other) Thank you. Regards [[alternative HTML version

[R] Floating simulation error

Hi all, I am running a simulation and a curious error keeps coming up that stops the whole process. The error is a subscript out of bounds error, and it seems to happen at different points (floating around) throughout the looping simulation. Say, for example, it crashes on sample 1 -

[R] update.packages(checkBuilt=TRUE) returns Error: invalid version specification NA in 2.9.0

I installed R-2.9.0 yesterday, and followed the instructions in the R for Windows FAQ, 2.8 What's the best way to upgrade? It reads run update.packages(checkBuilt=TRUE, ask=FALSE) in the new R and then delete anything left of the old installation. I did this but it returned an error. It's the

Re: [R] power.t.test formula

Usuario R wrote: Hi, Does anyone of you knows a reference for the formula used in power.t.test function? And also why it uses the Student's distribution instead of Normal. (I know both of them can be used but don't see whether choose one or the other) It is a straightforward

Re: [R] Floating simulation error

?traceback options(error) ( ?options) ?debug ?try ?tryCatch R has facilities to help you with such problems. Please use them -- and then repost with more specific info if you still cannot solve it. -- Bert Gunter -Original Message- From: r-help-boun...@r-project.org

Re: [R] Floating simulation error

Cosmic rays, perhaps? :) http://blog.revolution-computing.com/2009/04/blame-it-on-cosmic-rays.html Seriously though, my guess is that the simulation data from your 201st iteration is tickling some subtle bug in your code. This has happened to me before where I generate a random matrix that

Re: [R] Floating simulation error

-Original Message- From: r-help-boun...@r-project.org [mailto:r-help-boun...@r-project.org] On Behalf Of Brendan Morse Sent: Thursday, April 23, 2009 9:12 AM To: r-help@r-project.org Subject: [R] Floating simulation error Hi all, I am running a simulation and a curious error

Re: [R] fitting assimptotic decaing with - and + on X

Hi Christian, Thank you very much for the help. Now I can run. But my main interest is on the region of x[-200 to +200] and as you can see this logistic regression not fit very well. You think that using other package / function I can get better fit of these data? Best wishes, miltinho

[R] Load a data from oracle database to R

Hello, I am have trying to load data in R by connecting R to the database the following way: library(RODBC) channel-odbcConnect(gagan) now after I connect to the server by putting pwd. I want to load table from the database named temp in to R so that I can do some descriptive statistics with

[R] SAGE: was large factorials

On Wed, Apr 22, 2009 at 08:26:51PM -0700, Ben Bolker wrote: ??? octave is a Matlab clone, not a Mathematica clone (I would be interested in an open source Mathematica clone ...) ??? You might take a look at Sage. It is not a mathematica clone, but open source mathematical software

Re: [R] Load a data from oracle database to R

On Apr 23, 2009, at 12:18 PM, Gagan Pabla wrote: Hello, I am have trying to load data in R by connecting R to the database the following way: library(RODBC) channel-odbcConnect(gagan) now after I connect to the server by putting pwd. I want to load table from the database named temp in

[R] qqnorm.lme pairs.lme

Hello, I am trying to do some plotting to check random effect assumptions for a model I fit using lme. I want to use qqnorm and pairs (similarly to examples given in Pinheiro Bates p. 188), but it's not working. Here's some relevant code and the error message: library(nlme) data(Machines) m1

[R] R 2.8.1 change user input color of R scrpt too

Hello R community I'm using R 2.8.1 version and would like to change the color of user input for script pages. Once I have changed the color of console background and user input (by means of Interface Preferences menu), the color of script background has been automatically changed but the color

[R] How to construct confidence bands from a gls fit?

Dear R-list, I would like to show the implications of estimating a linear trend to time series, which contain significant serial correlation. I want to demonstrate this, comparing lm() and an gls() fits, using the LakeHuron data set, available in R. Now in my particular case I would like to draw

[R] suffix convention?

Hi, Is there some convention for choosing 'RData' or 'rda' for binary files written by save() or save.image()? The docs treat these interchangeably. Thanks. Cheers, -- Seb __ R-help@r-project.org mailing list

[R] simple for loop question - how do you exit?

I have a loop and an if statement in the loop. once the if statement is true for 1 value in the loop i'd like to exit the loop. is there a command to do this? i know its going to be something like exit and i feel stupid asking this question -- View this message in context:

  1   2   >