Hello, I think the problem is in Java version...
I put JAVA 6u12 as a requirement - If you have FireFox and 6u13 it should say something about wrong version of java, I think. The problem is that usually I use JAX-WS 2.1 so I need Java6u4+, but It's impossible (?) to specify it. I can put java6+ or exact version... To put something reasonable to the input you can put MKYMTVTDLNNAGATVIGTIKGGEWFLGTPHKDILSKPGFYFLVSKLDGRPFSNPCVSARFYVGNQRSKQGFSAVLSHIRQRRSQLARTIANNNMVYTVFYLPASKMKPLTTGFGKGQLALAFTRNHHSEYQTLEEMNRMLADNFKFVLQAY As a sequence string to execute the service... Dmitry Paul Fisher wrote: > I attach a picture of what I can see. Alan, do you have the latest Java, > and the new Web plugin thingie? > Note: in Firefox > > > > Paul. > > Dmitry wrote: > >> Hello Alan, >> >> I just removed "draggable" parameter (anyway it doesn't work now...) >> Does it help? >> >> Dmitry >> >> >> Alan Williams wrote: >> >> >>> Dmitry wrote: >>> >>> >>> >>>> Hello everybody, >>>> >>>> >>>> >>> Hello, >>> >>> >>> >>> >>>> For those who is interested in XML-Schema based component (to have an >>>> idea what I am thinking to implement) I just put my code as an applet here: >>>> >>>> http://inb.bsc.es/documents/java/moby/demo4/moby_miner.html >>>> >>>> >>>> >>> I can't get the page to load in firefox. It gives an error for: >>> >>> <script language="JavaScript" type="text/javascript"><!-- >>> if (_ie == true) document.writeln('<object >>> classid="clsid:CAFEEFAC-0016-0000-0012-ABCDEFFEDCBA" WIDTH = "100%" >>> HEIGHT = "100%" >>> codebase="http://java.sun.com/update/1.6.0/jinstall-6u12-windows-i586.cab#Version=6,0,120,4";><xmp>'); >>> else if (_ns == true && _ns6 == false) document.writeln('<embed ' + >>> 'type="application/x-java-applet;jpi-version=1.6.0_12" \ >>> CODE = "org.bionemus.tools.executor.gui.Main" \ >>> ARCHIVE = "NemusExecutor.jar, wsdl4j.jar, xsom.jar" \ >>> WIDTH = "100%" \ >>> HEIGHT = "100%" \ >>> java_arguments = "-Djnlp.packEnabled=true" ' + >>> draggable ="true" ' + >>> 'scriptable=false ' + >>> >>> 'pluginspage="http://java.sun.com/products/plugin/index.html#download";><xmp>'); >>> //--></script> >>> >>> Error: invalid assignment left-hand side >>> Source File: http://inb.bsc.es/documents/java/moby/demo4/moby_miner.html >>> Line: 30, Column: 22 >>> Source Code: >>> draggable ="true" ' + >>> >>> [snip] >>> >>> >>> >>> >>>> Cheers, >>>> >>>> Dmitry >>>> >>>> >>>> >>> Alan >>> >>> ------------------------------------------------------------------------------ >>> _______________________________________________ >>> taverna-hackers mailing list >>> [email protected] >>> https://lists.sourceforge.net/lists/listinfo/taverna-hackers >>> Developers Guide: http://www.mygrid.org.uk/usermanual1.7/dev_guide.html >>> FAQ: http://www.mygrid.org.uk/wiki/Mygrid/TavernaFaq >>> >>> >>> >>> >>> >> ------------------------------------------------------------------------------ >> _______________________________________________ >> taverna-hackers mailing list >> [email protected] >> https://lists.sourceforge.net/lists/listinfo/taverna-hackers >> Developers Guide: http://www.mygrid.org.uk/usermanual1.7/dev_guide.html >> FAQ: http://www.mygrid.org.uk/wiki/Mygrid/TavernaFaq >> >> > > > ------------------------------------------------------------------------------ > _______________________________________________ > taverna-hackers mailing list > [email protected] > https://lists.sourceforge.net/lists/listinfo/taverna-hackers > Developers Guide: http://www.mygrid.org.uk/usermanual1.7/dev_guide.html > FAQ: http://www.mygrid.org.uk/wiki/Mygrid/TavernaFaq > > > ------------------------------------------------------------------------------ _______________________________________________ taverna-hackers mailing list [email protected] https://lists.sourceforge.net/lists/listinfo/taverna-hackers Developers Guide: http://www.mygrid.org.uk/usermanual1.7/dev_guide.html FAQ: http://www.mygrid.org.uk/wiki/Mygrid/TavernaFaq
