Re: [Boston.pm] Tech Meeting 9/9 Creating And Managing a Private CPAN with Pinto Stratopan
Sweet! On Fri, Sep 5, 2014 at 1:48 PM, Bill Ricker bill.n1...@gmail.com wrote: Early announcement before weekend email hole ... TOPIC: Creating And Managing a Private CPAN with Pinto Stratopan DATE: September 9 TIME: 7:00 – 10:00 PM ROOM: MIT E51-376 SPEAKER: Jeffrey Thalhammer If you use Perl, then you have probably wrestled with CPAN. Shifting dependencies, incompatible interfaces, and test failures in CPAN modules can suddenly break your application, leaving your team to chase bugs they didn't create. But managing CPAN modules doesn't have to be painful. A private CPAN repository gives you a stable platform for making consistent builds and managing upgrades for all your Perl modules. In this session, you’ll learn how to use Pinto to create a private CPAN and build your applications with the right modules, every time. You’ll learn about the dangers of the public CPAN and how a private CPAN can help mitigate those risks. Finally, we’ll cover some of the newest features of Pinto and show you a few power-user tricks to get your private CPAN up and running quickly. Stratopan is a startup founded by the speaker that provides Private CPAN repositories securely hosted in the cloud. So Pinto is the tool that facilitates creating a private repository, and Stratopan lets you outsource the hosting of that repository. Jeffrey Ryan Thalhammer is a respected software developer, prolific open source contributor, and tech community leader. Author of Perl::Critic and Pinto, used by thousands of developers. Co-founder of Stratopan and Co-organizer of the San Francisco Perl Mongers. He consults under the brand Imaginative Software Systems. [see http://boston-pm.wikispaces.com/Calendar for pretty picture of a ?dependency? graph and embedded web links. ] Boilerplate details Tech Meetings are held on the 2nd Tuesday of every month at MIT building E51, Sloan School Tang Center [not the other Tang building!] nearer to Kendall Sq than Mass Ave. (directions http://boston-pm.wikispaces.com/MIT+Directions ). Talk begins at 7:30. Refreshments in the hallway prior. RSVP for count encouraged but not required, to bill.n1...@gmail.com or Boston-PM list, by 4pm Tuesday -- Bill Ricker bill.n1...@gmail.com https://www.linkedin.com/in/n1vux ___ Boston-pm mailing list Boston-pm@mail.pm.org http://mail.pm.org/mailman/listinfo/boston-pm ___ Boston-pm mailing list Boston-pm@mail.pm.org http://mail.pm.org/mailman/listinfo/boston-pm
Re: [Boston.pm] ver 5.20 of perl?
5.20 is the most recent stable release, so if they are trying to get current, that is it. Upgrading the system perl from 5.8.8 to 5.20 however is probably not advisable though. What is the role-out test plan? Who is responsible for fixing any code that breaks? What is the role-back plan? As fantastic as it would be, I've yet to work with anyone who actually moved forward with that on company-wide production servers after doing any real testing. You might suggest they look into perlbrew and maybe even pinto or carton as ways of managing installing 5.20 on all the production systems for deploying new code against without disrupting the system perl and everything that may depend on it. -HTH, Sean On Fri, Jun 27, 2014 at 11:17 AM, Greg London em...@greglondon.com wrote: one of the IT guys at work just asked what I thought about installing version 5.20.0 of perl on all our computers. We currently have 5.8.8. I don't even know if 5.20 is considered stable or not. Buggy? Issues? Is a different version better? Thoughts? My experience with IT (at every job I've ever worked at) is usually one of You have perl 5.4, that should be good enough. so, I wanted to make the most of this. Greg ___ Boston-pm mailing list Boston-pm@mail.pm.org http://mail.pm.org/mailman/listinfo/boston-pm ___ Boston-pm mailing list Boston-pm@mail.pm.org http://mail.pm.org/mailman/listinfo/boston-pm
Re: [Boston.pm] [Boston.pm-announce] Boston.pm.org Wiki status
Thanks Bill everyone! It was my pleasure to help out; particularly since my part was easy. ;) Cheers, Sean On Wed, Sep 11, 2013 at 11:28 AM, Bill Ricker bill.n1...@gmail.com wrote: And we're live with the new site as http://Boston.pm.org thanks Tom and Marla for the work prepping the new, and Sean for providing support for the old site for however many years it was. And Rob and rest of PM.ORG for the DNS support. Bill On Tue, Sep 10, 2013 at 10:05 PM, Bill Ricker bill.n1...@gmail.comwrote: Do not be alarmed if the wiki hiccups in the next few days. We're transitioning from an antique spam-ridden on Sean's virtual hosting -- for which we thank him for years of free-ride support, and do not blame HIM for the spam trap we built -- to a more secure freemium free service selected by Tom and converted by Maria. DNS change RT has been activated to move boston.pm.org to the new site, it will happen when it happens (and your DNS cache next expires after that). We'll move the remaining content over later (i've got backups of Calendar and History). Thanks again Sean, Tom, Maria, and PM.ORG team ! -- Bill @n1vux bill.n1...@gmail.com -- Bill @n1vux bill.n1...@gmail.com ___ Boston-pm-announce mailing list boston-pm-annou...@mail.pm.org http://mail.pm.org/mailman/listinfo/boston-pm-announce ___ Boston-pm mailing list Boston-pm@mail.pm.org http://mail.pm.org/mailman/listinfo/boston-pm
Re: [Boston.pm] Wiki conversion
Sounds fine to me. Let me know if there is anything specific you need from me. In the meantime I still have a bunch of sites to relocate over this weekend and even if those all go well (fracking email, joomla, etc), I still probably wouldn't get to boston.pm untill the following weekend at very the earliest. And if the new location isn't ready by the time I need to move it, that isn't terrible. All of these shared hosting accounts are still on basically the same version of perl, so it will _probably_ just work once restored from backup, with maybe a few config/path updates. But regardless, many thanks for all your help! -Cheers, Sean On Thu, Sep 5, 2013 at 10:07 PM, Maria Huang mhuang...@gmail.com wrote: Hi Sean, I converted some pages from http://boston.pm.org/kwiki to http://boston-pm.wikispaces.com/ already, but not all of them, like Tom said before, how calendar gets handled needs discussion, also I had thought do we need have a section to hold presentation or talk, and encourage members to sign up to this new site? I have been busy recently so I didn't work on it. I hope I can continue working on it soon but I need comments or suggestions what will be next step. I hope I answered your question. Best, Maria On Thu, Sep 5, 2013 at 8:41 PM, Sean Quinlan s...@quinlan.org wrote: Just pinging to get an idea if this is moving anywhere. I need to move boston.pm.org to a new hosting service. I can migrate everything, but it's one less thing to manage if I don't have to keep kwiki running post move. :) Cheers, Sean On Wed, Jul 31, 2013 at 7:32 AM, mhuang...@gmail.com wrote: Thanks for your detailed information, and this can give me a jump start, I will take a close look soon. Maria Sent from my iPhone On Jul 30, 2013, at 11:37 PM, Tom Metro tmetro+boston...@gmail.com wrote: Bill Ricker wrote: ...Wikispaces page. (I think I have a site setup for Boston.pm there, just awaiting content.) pointer ? that might kick start group use so make it worthwhile. http://boston-pm.wikispaces.com/ Created a year ago. I had intended to do an initial cut of the conversion, but it perpetually sits just out of reach at the bottom of my todo list. I guess now is as good a time as any to try and move it forward. Maria Huang wrote: ...I think I can convert pages at home... Yes, there's no need to do this as an in-person meeting. That was just an idea to create a meeting topic that would also be productive for the group. I think the reasoning behind not opening up the conversion to volunteers before is that Bill wanted to see how it would look before committing to switching over Boston.pm to use he new service. And any deadline for this? None. The sooner it goes done, the sooner Bill can reduce or eliminate his efforts to repair spam and vandalism that occurs with our current wiki. And where is old wiki site? http://boston.pm.org/kwiki/ ...just need some instructions. The first step is to go to: http://boston-pm.wikispaces.com/ and login (you can use OpenID) or create an account, and then request membership in the Boston.pm wikispace. I've picked a theme, colors, and created a logo. (That's the Ubuntu Mono font. I struggled to find something evocative of a terminal font that still looked OK when scaled up to logo size. That aside, I just combined the stock Perl onion with Boston.pm. You should compare it to the logo I did for the Boston.pm LinkedIn group, as you might like that better.) I converted over the main page. A little bit of intro text, links to pm.org, perl.org, our mailing list page (needs to be created), our jobs posting policy page (needs to be created), and I threw in a Creative Commons licensed picture of the Zakim Bridge for some cliché Boston flavor. I added a section titled Recent Meetings which will automatically display the 5 most recent wiki pages tagged as meeting. (It currently shows only page page titles. There are probably things we could do to get it to pull in a page summary or some such.) I created a sample meeting page for our last meeting just so the section above would have something to show. Well need to figure out a template for that, and settle on a page name format. Once the bulk of the data is moved over, time can then be spent revising the look and feel (or perhaps making it look less wiki-like), customizing the menus, and making better use of the embedded widgets they offer, like to embed a Google Calendar. Looking at my notes from a prior conversation with Bill, this is the list of pages that need to be converted (most parenthetical comments from Bill): Home page (first draft done) MITDirections JobPostingPolicy IrcRoom BostonPMCalendar MongerLists Damian2006Mementos
Re: [Boston.pm] Wiki conversion
Just pinging to get an idea if this is moving anywhere. I need to move boston.pm.org to a new hosting service. I can migrate everything, but it's one less thing to manage if I don't have to keep kwiki running post move. :) Cheers, Sean On Wed, Jul 31, 2013 at 7:32 AM, mhuang...@gmail.com wrote: Thanks for your detailed information, and this can give me a jump start, I will take a close look soon. Maria Sent from my iPhone On Jul 30, 2013, at 11:37 PM, Tom Metro tmetro+boston...@gmail.com wrote: Bill Ricker wrote: ...Wikispaces page. (I think I have a site setup for Boston.pm there, just awaiting content.) pointer ? that might kick start group use so make it worthwhile. http://boston-pm.wikispaces.com/ Created a year ago. I had intended to do an initial cut of the conversion, but it perpetually sits just out of reach at the bottom of my todo list. I guess now is as good a time as any to try and move it forward. Maria Huang wrote: ...I think I can convert pages at home... Yes, there's no need to do this as an in-person meeting. That was just an idea to create a meeting topic that would also be productive for the group. I think the reasoning behind not opening up the conversion to volunteers before is that Bill wanted to see how it would look before committing to switching over Boston.pm to use he new service. And any deadline for this? None. The sooner it goes done, the sooner Bill can reduce or eliminate his efforts to repair spam and vandalism that occurs with our current wiki. And where is old wiki site? http://boston.pm.org/kwiki/ ...just need some instructions. The first step is to go to: http://boston-pm.wikispaces.com/ and login (you can use OpenID) or create an account, and then request membership in the Boston.pm wikispace. I've picked a theme, colors, and created a logo. (That's the Ubuntu Mono font. I struggled to find something evocative of a terminal font that still looked OK when scaled up to logo size. That aside, I just combined the stock Perl onion with Boston.pm. You should compare it to the logo I did for the Boston.pm LinkedIn group, as you might like that better.) I converted over the main page. A little bit of intro text, links to pm.org, perl.org, our mailing list page (needs to be created), our jobs posting policy page (needs to be created), and I threw in a Creative Commons licensed picture of the Zakim Bridge for some cliché Boston flavor. I added a section titled Recent Meetings which will automatically display the 5 most recent wiki pages tagged as meeting. (It currently shows only page page titles. There are probably things we could do to get it to pull in a page summary or some such.) I created a sample meeting page for our last meeting just so the section above would have something to show. Well need to figure out a template for that, and settle on a page name format. Once the bulk of the data is moved over, time can then be spent revising the look and feel (or perhaps making it look less wiki-like), customizing the menus, and making better use of the embedded widgets they offer, like to embed a Google Calendar. Looking at my notes from a prior conversation with Bill, this is the list of pages that need to be converted (most parenthetical comments from Bill): Home page (first draft done) MITDirections JobPostingPolicy IrcRoom BostonPMCalendar MongerLists Damian2006Mementos (with images, historical) BostonPMHistory (historical; Add entry marking end of kwiki) TechMeetingTopics (idea queue) There is another 4 or 5 less important pages that should also be converted at some point. How the calendar gets handled needs discussion. Bill suggested The Calendar could reasonably get split into history-by-year pages to reduce max size. Or not. My first instinct would be to handle it the same way the Recent Meetings section is handled on the home page, using a widget that displays a list of pages matching a tag. This way the calendar page could have either a single widget or perhaps one per year, while each meeting then gets its own page. As for using Wikispaces itself, you can create a new page by: -typing in the URL where you would like it to be; it'll prompt you to create a new page; -create a link to the new page, then click on the link; -Select the Pages and Files menu option, and then click the new page button. In the upper right you'll find a Help link on every page, which will take you to extensive documentation on how to use Wikispaces. For the most part, due to the WYSIWYG editor, you won't need it. Occasionally it is helpful to modify the wiki markup text. To access that, click the down arrow next to the save button when editing a page, and choose Wikitext Editor. -Tom -- Tom Metro Venture Logic, Newton, MA, USA Enterprise solutions
Re: [Boston.pm] Wiki conversion
Not my kwiki! :P No emergency, I think we have a couple weeks still before we'd have to renew the old hosting if it isn't moved (one way or another). Cheers, Sean On Thu, Sep 5, 2013 at 10:41 PM, Bill Ricker bill.n1...@gmail.com wrote: Hi. Sean, yes, we'll abandon your kwiki, and it looks like wikispaces a viable alternative. I can request PM.ORG move the DNS to refer to the new wikispaces moderately quickly, give me a few days before you have to pull the plug. What's the timeframe? Maria, i acknowledge the existing Calendar history scroll is crazy, it needed refactoring someday. I'm open to sensible suggestions how to reorganize it. Key to me is saving the history, the content. (Moving to a new wiki we break any deeplinks anyway, so no value to preserving structure.) If Wikispaces has good ways to announce coming events, go ahead and use them. You can add September meeting as a coming event, it will be Patching and Updating a CPAN Module with Bill and Tom. (-: Whether Tom can attend or not, he's co-maintainer :-) -- bill On Thu, Sep 5, 2013 at 10:07 PM, Maria Huang mhuang...@gmail.com wrote: Hi Sean, I converted some pages from http://boston.pm.org/kwiki to http://boston-pm.wikispaces.com/ already, but not all of them, like Tom said before, how calendar gets handled needs discussion, also I had thought do we need have a section to hold presentation or talk, and encourage members to sign up to this new site? I have been busy recently so I didn't work on it. I hope I can continue working on it soon but I need comments or suggestions what will be next step. I hope I answered your question. Best, Maria On Thu, Sep 5, 2013 at 8:41 PM, Sean Quinlan s...@quinlan.org wrote: Just pinging to get an idea if this is moving anywhere. I need to move boston.pm.org to a new hosting service. I can migrate everything, but it's one less thing to manage if I don't have to keep kwiki running post move. :) Cheers, Sean On Wed, Jul 31, 2013 at 7:32 AM, mhuang...@gmail.com wrote: Thanks for your detailed information, and this can give me a jump start, I will take a close look soon. Maria Sent from my iPhone On Jul 30, 2013, at 11:37 PM, Tom Metro tmetro+boston...@gmail.com wrote: Bill Ricker wrote: ...Wikispaces page. (I think I have a site setup for Boston.pm there, just awaiting content.) pointer ? that might kick start group use so make it worthwhile. http://boston-pm.wikispaces.com/ Created a year ago. I had intended to do an initial cut of the conversion, but it perpetually sits just out of reach at the bottom of my todo list. I guess now is as good a time as any to try and move it forward. Maria Huang wrote: ...I think I can convert pages at home... Yes, there's no need to do this as an in-person meeting. That was just an idea to create a meeting topic that would also be productive for the group. I think the reasoning behind not opening up the conversion to volunteers before is that Bill wanted to see how it would look before committing to switching over Boston.pm to use he new service. And any deadline for this? None. The sooner it goes done, the sooner Bill can reduce or eliminate his efforts to repair spam and vandalism that occurs with our current wiki. And where is old wiki site? http://boston.pm.org/kwiki/ ...just need some instructions. The first step is to go to: http://boston-pm.wikispaces.com/ and login (you can use OpenID) or create an account, and then request membership in the Boston.pm wikispace. I've picked a theme, colors, and created a logo. (That's the Ubuntu Mono font. I struggled to find something evocative of a terminal font that still looked OK when scaled up to logo size. That aside, I just combined the stock Perl onion with Boston.pm. You should compare it to the logo I did for the Boston.pm LinkedIn group, as you might like that better.) I converted over the main page. A little bit of intro text, links to pm.org, perl.org, our mailing list page (needs to be created), our jobs posting policy page (needs to be created), and I threw in a Creative Commons licensed picture of the Zakim Bridge for some cliché Boston flavor. I added a section titled Recent Meetings which will automatically display the 5 most recent wiki pages tagged as meeting. (It currently shows only page page titles. There are probably things we could do to get it to pull in a page summary or some such.) I created a sample meeting page for our last meeting just so the section above would have something to show. Well need to figure out a template for that, and settle on a page name format. Once the bulk of the data is moved over, time can then be spent revising the look and feel (or perhaps making it look less wiki-like
Re: [Boston.pm] going to yapc?
I'll be there. :) Cheers, Sean On Mon, May 13, 2013 at 11:52 PM, Uri Guttman u...@stemsystems.com wrote: hi all, just wondering who is going to yapc::austin? i and the wife will be there. she wants to see austin. thanx, uri __**_ Boston-pm mailing list Boston-pm@mail.pm.org http://mail.pm.org/mailman/**listinfo/boston-pmhttp://mail.pm.org/mailman/listinfo/boston-pm ___ Boston-pm mailing list Boston-pm@mail.pm.org http://mail.pm.org/mailman/listinfo/boston-pm
Re: [Boston.pm] possible talk for next week
But the 21st is Mardi Gras!! ;) I would not be attending on the 14th; my wife and I will be happily ensconced on our couch, eating our favorite take-out and watching a movie. I should be able to make the 21st if there there are enough others going to re-schedule (and if Bill is able and willing to put in the effort and MIT allows). Otherwise I'm OK waiting until April. Cheers, Sean On Fri, Feb 10, 2012 at 11:52 AM, Uri Guttman u...@stemsystems.com wrote: On 02/10/2012 11:19 AM, Morse, Richard E.MGH wrote: On Feb 10, 2012, at 11:11 AM, Steven W. Orr wrote: Hold on thar Bullwinkle! Let's analyze what you just said: You want to suggest that it's appropriate to reschedule a lecture on *perl* so that a bunch of sad males, married or otherwise, will be validated to stand in huge lines, to buy expensive vegetation, in some vague attempt to satisfy the artificial societal pressure imposed by the dual cabal of the krypto-fascist flower industry and the opposite sex? I think not. Remember what they say in Japan: Everyone wants to be where everyone else wants to be. Uri, I love you like a niece, but I'd rather give you the flowers on some random day that doesn't include images of cherubs with ancient weaponry than to my own wife at the appointed hour. I'm not sure if this means that you want to have the meeting or not :-? steve is a long time friend who is just busting me here. my issue is more about low attendance. i got a couple of off list (those should be on list!) replies expressing interest and unlikely to attend. so to have a better crowd, i suggested punting on v day. very few so far have said they would attend that night. most or at least many of us are actually in relationships and regardless of steve's sentiment (or lack thereof), market and social forces exert extreme pressure to spend cash and time on these made up holidays! :) my wife actually would let me go to the meeting as we have something booked for the next night. so back to the actual topic. do we reschedule for tues feb 21, or punt altogether and i do this talk in april? thanx, uri __**_ Boston-pm mailing list Boston-pm@mail.pm.org http://mail.pm.org/mailman/**listinfo/boston-pmhttp://mail.pm.org/mailman/listinfo/boston-pm ___ Boston-pm mailing list Boston-pm@mail.pm.org http://mail.pm.org/mailman/listinfo/boston-pm
Re: [Boston.pm] Wiki Spam
I'd agree. And I figure we can give edit accounts to any regular participant who wants to lend a hand. Cheers, Sean On Thu, Jan 12, 2012 at 12:29 AM, Federico Lucifredi flucifr...@acm.orgwrote: we probably don't need a wiki. Content management ahoy! Just my 5 cents. Best-F On Jan 11, 2012, at 9:50 AM, Bill Ricker wrote: On Tue, Jan 10, 2012 at 3:37 PM, Tom Metro tmetro-boston...@vl.com wrote: I'll reiterate a prior recommendation to use Wikispaces. It's been working fine for BLU and a few other projects with minimal maintenance effort. (Much nicer wiki UI than kwiki, too.) If you set it to require a login (OpenID) you pretty much eliminate spam. The big downside to it is that you have to pay in order to use a fully custom domain, otherwise you get a subdomain, which you could redirect to from your desired domain. Tom's offer is very much appreciated. My previous reply was along the lines that we'd had so little wiki-ish authoring activity (aside from the spammers) that I doubting the conversion was worth the effort and cost, was wondering if we'd have a better fit moving to a Content Management System (such as the minimalist WEBDAV that pm.org supplies -- that Jerrad and I used on Advent 2.0 -- or something fancier, hopefully Perl based, maybe runnable where our wiki is now (Quinlan's)). For FAQ/contact pages and a monthly calender update we don't need much -- and only the few who actually do the editing need write access. That's all that's really happening now. I would like comment on those requirements -- do we need a wiki ? if so, what is who going to do with it that they haven't lately ? -- Bill @n1vux bill.n1...@gmail.com ___ Boston-pm mailing list Boston-pm@mail.pm.org http://mail.pm.org/mailman/listinfo/boston-pm _ -- 'Problem' is a bleak word for challenge - Richard Fish (Federico L. Lucifredi) - flucifredi at acm.org - GnuPG 0x4A73884C ___ Boston-pm mailing list Boston-pm@mail.pm.org http://mail.pm.org/mailman/listinfo/boston-pm ___ Boston-pm mailing list Boston-pm@mail.pm.org http://mail.pm.org/mailman/listinfo/boston-pm
[Boston.pm] RSVP: Tech meeting TONIGHT
Please RSVP if you are expecting to make tonight’s Boston.pm tech meeting. Thanks, Sean -- Forwarded message -- From: Bill Ricker bill.n1...@gmail.com Date: Tue, Jan 10, 2012 at 9:22 AM Subject: [Boston.pm-announce] Tech meeting TONIGHT - new Web bug affects multiple languages, but not Perl To: Boston Perl Mongers (announce) boston-pm-annou...@pm.org, Boston Perl Mongers boston...@pm.org Next Tech Meeting Tuesday, January 10, 2012 7 – 10p.m. MIT E51-376 David Larochelle will explain the new multi-language web Denial of Service (DoS http://boston.pm.org/kwiki/index.cgi?DoS) threat that doesn't affect Perl (but affects Python PHP). http://www.nruns.com/_downloads/advisory28122011.pdf CVE-2011-4885 Phuket property http://www.phuketproperty.com/ Reported 2003 http://www.cs.rice.edu/~scrosby/hash/CrosbyWallach_UsenixSec2003.pdf Fixed in Perl 2005 http://perldoc.perl.org/perlsec.html#Algorithmic-Complexity-Attacks This will be the last time in the summer room E51-376. We'll return to old traditional E51-372 for Feb - May. (confirmed) Speaking of security ... if your home (or office) router has WPS simple setup feature, TURN WPS OFF. NOW. Wi-Fi Protected Setup (WPS) PIN Brute Force Vulnerability https://isc.sans.edu/diary/Wi-Fi+Protected+Setup+WPS+PIN+Brute+Force+Vulnerability/12292 Sean is acting facilitator for this session, so please RSVP to the main list boston...@pm.org -- Bill @n1vux bill.n1...@gmail.com ___ Boston-pm-announce mailing list boston-pm-annou...@mail.pm.org http://mail.pm.org/mailman/listinfo/boston-pm-announce ___ Boston-pm mailing list Boston-pm@mail.pm.org http://mail.pm.org/mailman/listinfo/boston-pm
Re: [Boston.pm] [Boston.pm-announce] Tech Meeting January 11th, at MIT E51-376 7 ~ 7:30pm
Jeez Uri, at least let him just come enjoy a few meetings before you start trying to recruit him again!! :P -Sean On Tue, Jan 11, 2011 at 1:18 PM, Uri Guttman u...@stemsystems.com wrote: RJK == Ronald J Kimball r...@tamias.net writes: RJK I plan to be there tonight. I'm interested in seeing the approach to RJK solving cryptograms. RJK (I think this will be my first tech meeting since I stepped down as RJK facilitator!) hey! since bill may miss feb's meeting, wanna be the previous fearless leader interim replacement fearless leader for that? uri -- Uri Guttman -- u...@stemsystems.com http://www.sysarch.com-- - Perl Code Review , Architecture, Development, Training, Support -- - Gourmet Hot Cocoa Mix http://bestfriendscocoa.com- ___ Boston-pm mailing list Boston-pm@mail.pm.org http://mail.pm.org/mailman/listinfo/boston-pm ___ Boston-pm mailing list Boston-pm@mail.pm.org http://mail.pm.org/mailman/listinfo/boston-pm
Re: [Boston.pm] Back to Conferences RE: what Perl can do at non-Perl Conferences
On Wed, Mar 17, 2010 at 10:49 PM, Bill Ricker bill.n1...@gmail.com wrote: I am not opposed to Best or Better, except as striving for such blocks Good Enough. Ditto. I also think just having a presence there, being able to answer questions and maybe talk about the most interesting recent events/trends/features of Perl (5.10, Modern Perl, whatever), could be beneficial. However I would also like to point out that it may also benefit Boston.pm. FIRST - HOW MANY of WE would be interested? Possibly available then? Might buy a badge to contribute? Might get work to buy a badge, but would have to like actually attend some panels on Linux to justify the expense? Might get/make time off to work, but only if a FLOSS booth exhibitor badge is donated? Send message to other PM groups asking who is coming? (URI Ronald I have access to that list of list-owners)) Definitely interested and would volunteer to help out. Would buy a badge if needed. SECOND - WHAT * ask TPF if they have any official plans for LinuxCon Boston ... ... and if so offer $n locals to help; ... if not, would we ... * sponsor a Perl Birds of a feather session, Oh, good idea. * hold social event for us the out-of-town PM.ers Perl-friendly penguinistas, Now we're talking! maybe scheduled so far ahead it's in the official program ? * Our Own Booth - if LinuxCon have free .org zone or cheap FLOSS rate ? * only if so does which Agenda, which marketing angle, if any matter, which decision does NOT need to be made now, and may depend on whose money sweat and name is on the booth I might be able to bring in some $. * if not our own booth, maybe help at Boston Linux / Unix booth (assuming they get one) wearing camel camelia onion logos loud proud for a presence, with any collateral material we can scrounge. I usually play well with others. DOES ANYBODY HAVE INTEREST IN BEING PARTY TO ANY OF THOSE? So yes. Though as stated before I'll be out of town for ~3 weeks just before so I could not be an organizer on this effort. -Sean ___ Boston-pm mailing list Boston-pm@mail.pm.org http://mail.pm.org/mailman/listinfo/boston-pm
Re: [Boston.pm] what Perl can do at non-Perl Conferences
I will be away on vacation the three weeks prior unfortunately, but this looks like it would be a great idea! I can't help organize but I will volunteer to staff the booth for at least 1 of the days if someone does make the arrangements. Regards, Sean On Mon, Mar 8, 2010 at 6:46 AM, Bill Ricker bill.n1...@gmail.com wrote: *...@perlfoundation http://twitter.com/perlfoundation* Two reviews of the Perl presence at CeBit - http://bit.ly/aS2EDH, http://bit.ly/aEy3Xx Sounds successful. Do we want to do something at the LinuxCon in South Boston in August ? ___ Boston-pm mailing list Boston-pm@mail.pm.org http://mail.pm.org/mailman/listinfo/boston-pm ___ Boston-pm mailing list Boston-pm@mail.pm.org http://mail.pm.org/mailman/listinfo/boston-pm
Re: [Boston.pm] Fwd: Perl e-books bargain / $9.99 Learning Perl and Mastering Perl e-books from O'Reilly
Fantastic news Bill, thanks!!! Hopefully we'll see more O'reily books becoming available at these discounts. And to encourage such, off I go to purchase a copy of each. Um, anyone remember our discount code? ;) Regards, Sean On Tue, Aug 25, 2009 at 9:15 AM, Bill Ricker bill.n1...@gmail.com wrote: $9.99 Learning Perl and Mastering Perl e-books from O'Reilly [ #39524 ] Monday August 24, 2009 04:00 PM http://use.perl.org/~brian_d_foy/journal/http://use.perl.org/%7Ebrian_d_foy/journal/ http://use.perl.org/article.pl?sid=09/08/24/2012226 O'Reilly dropped the regular price of e-books for Learning Perl [1] and Mastering Perl [2] to $9.99. I volunteered to be the guinea pig for pricing experiments. I specifically want to see if this makes it easier to get these books when access to the hard-copies is prohibitively expensive. You can get these books in Mobi, PDF, or ePub directly from O'Reilly. I'd like to do more of these sorts of experiments to get the books into as many hands as possible. The $9.99 price is the regular price, so all existing discount and coupon codes apply. For instance, you can still use the 35% user group discount to get either book for $6.50. These are the updated versions of the books too. All reported errata should be corrected, so they are slightly fresher than the hard copies. Remember, the great thing about PDFs is that they don't take up any shelf space. Buy as many as you like! [1] http://oreilly.com/catalog/9780596520106/ [2] http://oreilly.com/catalog/9780596527242/ ___ Boston-pm mailing list Boston-pm@mail.pm.org http://mail.pm.org/mailman/listinfo/boston-pm -- Sean Quinlan gpg public-key http://grendels-den.org/sean.asc ___ Boston-pm mailing list Boston-pm@mail.pm.org http://mail.pm.org/mailman/listinfo/boston-pm
Re: [Boston.pm] I didn't realize that some of Git is conceptually based on early work by Sean Quinlan!
Damn, and I sounded so cool for a minute there! ;) On Thu, Jun 25, 2009 at 11:03 PM, Chris Devers chris.dev...@gmail.comwrote: On Thu, Jun 25, 2009 at 10:53 PM, Bob Clancybob.cla...@verizon.net wrote: As I'm reading the beginning of the OReilly Git book ( http://my.safaribooksonline.com/9780596158187/pre-Preface#X2ludGVybmFsX1NlY3Rpb25Db250ZW50P3htbGlkPTk3ODA1OTYxNTgxODcvc2VjLWludHJvLVByZWNlZGVudHM= ) I see a link to a paper with a familiar name: The Venti Filesystem, (Plan 9), Bell Labs, http://www.usenix.org/events/fast02/quinlan/quinlan_html/index.html The Bell Labs / Google Sean Quinlan is not the same as Our Sean Quinlan: http://en.oreilly.com/velocity2008/public/schedule/speaker/26232 Different resume; seems to be a decade or more older. -- Chris Devers ___ Boston-pm mailing list Boston-pm@mail.pm.org http://mail.pm.org/mailman/listinfo/boston-pm -- Sean Quinlan gpg public-key http://grendels-den.org/sean.asc ___ Boston-pm mailing list Boston-pm@mail.pm.org http://mail.pm.org/mailman/listinfo/boston-pm
Re: [Boston.pm] New Facilitator
There's a boston.pm IRC channel? Nice On Sat, 2008-06-28 at 10:27 -0400, Bill Ricker wrote: I know that Bill intends to share some of the responsibilities of leading our group. Lets us know what you need help with. I already got some help last month ... When I am at home (not work alas) I am logged into #boston.pm on perl.org IRC. Has been VERY VERY quiet lately. Come on back. ___ Boston-pm mailing list Boston-pm@mail.pm.org http://mail.pm.org/mailman/listinfo/boston-pm
[Boston.pm] possible bug?
A quick background overview. I have a relatively simple tool for
generating six-frame translations of a genome (all possible protein
segments encoded in a genome). I read through the input one codon (3 DNA
bases) at a time, keeping the previous codon, and build the sequence
fragments in six separate scalars. Every codon I check to see if any of
the fragments end in a 'stop' codon, and if so call a function that
checks if the fragment is = the min length and if so formats the output
and returns that. The scalar containing the fragment is passed by
reference and 'cleared' ( $$sref = '') in the stop function. The
formated output, if any, is accumulated in a temp variable and, if
anything was returned, the contents are output. The original way I
handled this caused, seemingly at random, the output of fragments to be
repeated over a number of iterations, but after a small change the
problem went away, although I would have thought the change to be
equivilent. Here's a stripped down version of the first method:
my ($seq1,$cseq1,...) = '';
while($codon = $read_code) {
my $six = $last . $codon;
$last = $codon;
$pos+=3;
$seq1 .= $AA{$codon} || X;
complement(\$codon);
$cseq1 .= $AA{$codon} || X;
# etc for other two frames
my $out = _stop(\$seq1,$pos,$minlen,$id) if $seq1 =~ /\.$/;
$out .= _stop(\$cseq1,$pos,$minlen,$id,$dna_len)
if $cseq1 =~ /\.$/;
# etc for all frames
print $fh_out $out if $out;
} # while reading codons from genome
Key lines in _stop:
if ($len $min) { undef($$sref_seq);return '' }
$ret = $id\t$$sref_seq\t$start\t$end\n;
$$sref_seq = '';
return $ret;
The above code causes the same fragment to be output multiple times.
Some debugging has concluded that _stop is only being called when
expected and that $seq1 etc. are being set to empty string as intended.
I also determined that the repeat was being printed in sucsesive
iterations of the while loop, only as long as a return from _stop didn't
assign a new value other than '' to $out. For example, if I output a
simple loop counter, then I would see somthing like:
141:
SixFrame sequence 278 141
142:
SixFrame sequence 278 141
143:
SixFrame sequence 278 141
144:
145:
146:
etc., where only the output on iteration 141 was expected.
Where the 'SixFrame' line is the content of $out. There doesn't seem to
be any obvious pattern to how many times the output would be repeated,
but I didn't bother to investigate that deeply. Changing the my $out =
_stop line in the while loop above to:
my $out = '';
$out .= _stop(\$seq1,$pos,$minlen,$id) if $seq1 =~ /\.$/;
Seems to have completely solved the problem. Is this some sort of
mistake on my part, some subtle/odd behavior that would cause this to be
expected in this usage (and if so please explain), or should I report
this as a bug [no, I haven't trolled the known bugs/fixes yet, sorry]
285: 11:45am % uname -a
Linux .xxx.xxx 2.4.20-43.9.legacysmp #1 SMP Tue Apr 26 08:08:36 EDT
2005 i686 athlon i386 GNU/Linux
286: 11:45am % perl -v
This is perl, v5.8.6 built for i686-linux-thread-multi
...
Thanks!
--
Sean Quinlan [EMAIL PROTECTED]
signature.asc
Description: This is a digitally signed message part
___
Boston-pm mailing list
Boston-pm@mail.pm.org
http://mail.pm.org/mailman/listinfo/boston-pm
Re: [Boston.pm] tech meeting?
I'm starting to have real complications scheduling meetings with BU. I'm looking into other avenues w/in the bureaucracy to schedule through. I can host the meeting in my groups conference room, but it only holds 15 or so. If anyone can come up with a good location, either for this month or longer term, please step forward. Until I hear otherwise I will continue to try to find us space ASAP. On Sat, 2005-06-11 at 09:57 -0400, Dan Sugalski wrote: At 9:42 AM -0400 6/11/05, Uri Guttman wrote: are we going to have a tech meeting some time again? it's been a good while. i have some swag from o'reilly to give out to book reviewers: the perl template toolkit and mastering regular expressions 2nd ed. both are well known and liked books so if you want them you just need to put up a review on some public site like books.perl.org, amazon, etc. Hey, if we have one before YAPC::NA I can give a runthrough of the memory use/reduction talk I'm giving there... :) -- Sean Quinlan [EMAIL PROTECTED] ___ Boston-pm mailing list Boston-pm@mail.pm.org http://mail.pm.org/mailman/listinfo/boston-pm
Re: [Boston.pm] Empty radio and checkboxes not passed to perl scr ipt
On Fri, 2005-05-27 at 10:43 -0400, Uri Guttman wrote: JR == Jim Rose [EMAIL PROTECTED] writes: JR I'm missing something here. Why can't you just test to see if the JR variable is defined or not on your script? because he doesn't know in the code what the list of fields is. he needs to either parse the html survey page or have some other file with that list so he can validate them. he knows he can parse the html but he doesn't want to do that (not sure why as it won't be hard). or he needs to do some redesign where the fields are in a separate file (which the validation code reads) and the html is templated or generated from that. Sorry I'm coming in late and without reading the whole thread. But if it's his code generating the survey pages (presumably based directly on client input to a form or such), why can't he just have a single hidden field with all the field names generated? I've had code working on input generated from data in a database where the fields can change, and do that rather than go back to the database (we do that in debug mode for testing/validation). I've done similar things when pages are in development so the handling code doesn't need to make assumptions about what fields it should get. ??? OK, I suppose I should go read the thread. ;) -- Sean Quinlan [EMAIL PROTECTED] signature.asc Description: This is a digitally signed message part ___ Boston-pm mailing list Boston-pm@mail.pm.org http://mail.pm.org/mailman/listinfo/boston-pm
Re: [Boston.pm] Empty radio and checkboxes not passed to perl scr ipt
On Thu, 2005-05-26 at 11:16 -0400, Chris Devers wrote: On Thu, 26 May 2005, Alex Brelsfoard wrote: Picture a web form that is some sort of a survey. When that survey is submit the perl script writes out the answers onto a file. That file is tab delimited. Stop right there, doctor, I think we've found the problem. If you used a more robust storage format, this problem would go away, Aw now that's not nice. I _live_ on tab delimited files! :P right? For simple, you could just do something like the Windows INI format, ewww - let's just skip on past this ;) Or you could get fancy and use a tied hash, a BDB database, a SQLite database, or a proper database server. Assuming you don't want to use a proper database for some reason (though you should consider it), Chris is correct in pointing out that other data storage formats might be better. DBD or SQLite could be handy, but even YAML could solve your problem. Read in the current set of values, increment/add to the data structure as you parse submission and re-export. Granted, this answer doesn't scale well to thousands of responses and would need to protect against race conditions on the file, but for small surveys it's just fine. And if they are big, then why not a database? What am I missing? Does your code generate the form that the survey is submitted from? How does the client input the survey? We're assuming from your original post that somehow a client generates a survey where you don't know what the fields might be, but then that users submit answers one user at a time and you accumulate these results and return a tab delimited file with the results at some point. Is that correct? -- signature.asc Description: This is a digitally signed message part ___ Boston-pm mailing list Boston-pm@mail.pm.org http://mail.pm.org/mailman/listinfo/boston-pm
Re: [Boston.pm] Fwd: Can you better this?
On Wed, 2005-05-11 at 15:21 -0400, Bogart Salzberg wrote:
#!/usr/bin/perl
# by Bogart Salzberg, InkFist.Com
for (12345 .. 54321) {
print ++$count, \t, $_, \n if /
([1-5])
(?!\1)([1-5])
(?!\1|\2)([1-5])
(?!\1|\2|\3)([1-5])
(?!\1|\2|\3|\4)([1-5])
/x;
}
Nice! Inspired this slightly simplified version:
for (12345 .. 54321) {
print ++$count, \t, $_, \n
if /[1-5]{5}/ ! /([1-5]).*(\1)/;
}
___
Boston-pm mailing list
Boston-pm@mail.pm.org
http://mail.pm.org/mailman/listinfo/boston-pm
Re: [Boston.pm] Can you better this?
On Wed, 2005-05-11 at 13:11 -0700, Ben Tilly wrote:
Do I smell golf?
perl -le 'map/(.).*\1/||print,glob{1,2,3,4,5}x5'
Nice!
I was just playing with a map version trying to see how to shorten my
regex.
perl -e 'map {print$_,\nif/[1-5]{5}/! /([1-5]).*\1/} (12345..54321)'
--
Sean Quinlan [EMAIL PROTECTED]
___
Boston-pm mailing list
Boston-pm@mail.pm.org
http://mail.pm.org/mailman/listinfo/boston-pm
[Boston.pm] YAPC::NA rideshare
I'm considering attending YAPC this summer, and was considering driving. Is anyone else planning on driving and would like a backup (or primary) driver who is willing to chip in on costs? Or would anyone be interested in being a backup driver and chip in on costs with me (I'd be renting, size of vehicle dependent on # of passengers). I'm not looking for any firm commitments yet, just seeing if there would be interest before I make any decisions. Thanks, -- Sean Quinlan [EMAIL PROTECTED] signature.asc Description: This is a digitally signed message part ___ Boston-pm mailing list Boston-pm@mail.pm.org http://mail.pm.org/mailman/listinfo/boston-pm
Re: [Boston.pm] next meeting?
On Thu, 2005-03-31 at 21:43 -0500, Ian Langworth wrote: I recommend at _least_ a social meeting. Burgers just aren't the same without miscellaneous Perl trivia. I put in a request earlier this week for room reservations for the next three months on days that I was available. The next should be April 12th. I'll email Ronald as soon as I get confirmation and a room# (hopefully the usual room). But a burger meet sounds fantastic! -- Sean Quinlan [EMAIL PROTECTED] signature.asc Description: This is a digitally signed message part ___ Boston-pm mailing list Boston-pm@mail.pm.org http://mail.pm.org/mailman/listinfo/boston-pm
RE: [Boston.pm] advocacy, et al.
And you just finally chime in today!?! :P Thanks, I'll check it out. On Sat, 2005-03-12 at 08:48 -0500, Dan Collis Puro wrote: On Fri, 2005-03-11 at 22:59 -0600, Andres Monroy-Hernandez wrote: Stephen, In my opinion, one of the best CMS written Perl is WebGUI: http://www.plainblack.com/webgui. But I am not sure if you must have root and shell access to install it. By the way, Oddmuse looks pretty cool. I'll give it a try. -Andres I'm one of the core WebGUI developers. I haven't been doing much with it recently because we're going through some massive API changes in preparation of upcoming stable branch (you know the drill- it's ready when it's ready) and I've been incredibly busy with other stuff. . . Anyway: progress is being made rapidly, though, and I feel confident we'll be stable soon. WebGUI, in terms of high-level tools for managing websites, sits a level above Plone/Zope and a few levels above other toolkits like Axkit, HTML::Mason, and OpenACS. (Mason is very cool, I'm just picking it up after years coding CGI::Application/HTML::Template apps, writing my first HTML::Mason/Alzabo e-commerce system.) The neatest thing about WebGUI is that it conceives of websites the way a lot of people do- to WebGUI, a site is just a bunch of pages with things on them. Those things can be articles, discussion forums, blogs, image galleries, Syndicated RSS content, FAQ lists, etc. You can copy an already created object and paste it elsewhere on the site, create shortcuts to objects, and in the new branch drag-and-drop content around the page to re-arrange it. With WebGUI I can create feature-rich user-managed sites very quickly, and non-technical folks can manage them. One exampe: update a blog, a user just needs to sign in, move to the page, hit new posting, type, and hit save. More advanced folks can do a lot more, obviously. WebGUI is pretty easily extended (once you learn the API) and doesn't reinvent the wheel every chance they get- we use a plethora of modules- HTML::Template, CGI.pm, HTML::TagFilter, HTML::Highlight, etc. There is a bit of a 'maverick' feel to some of the development (I'd love to see stuff generalized a bit more so that it can be released to CPAN) but overall there is a very competent developer community. WebGUI dictates very little about how a site should look- you aren't trapped into the three-column boxes on the left, boxes on the right, content in the middle paradigm at all, you can drop stuff anywhere and arrange your auto-updating navigation stuff in a bunch of different ways. Nearly everything is templatted in HTML::Template, and you can edit the templates right in your browser. Unlike some of the pukey PHP systems out there, you don't have to edit a mixture of code and presentation or deal with this false templatting of skins where can only change very specific bits related to presentation. You can make it look *however* you want, without a lot of non-obvious boundaries. The entire management interface is translated into some ungodly amount of languages, it's got a user/group based permission system and a MUCH improved internal search engine in the new branch. To run WebGUI with acceptable performance it needs to run under mod_perl. For some hosts that may mean you can run it without root access, and I suppose you could install without shell access, too. But that would suck. If you're familiar with perl and *nix, you probably wouldn't have a lot of trouble setting it up. I host a bunch of WebGUI instances for clients, it's pretty stable and can handle a lot of traffic- I had one client that got hammered (including two slashdottings) around the election and WebGUI (and some custom mod_perl handlers) took it easily. Of all the CMSs I've evaluated, WebGUI offers the best chance that non-technical users will actually be able to use it quickly without a lot of custom development and huge amounts of training on your part. I've got a bunch of clients that barely understand how anything works about the web that can still keep stuff up to date. Stuff I want to see get better is a meta-data system that allows for faceted classification and more complete XML/RSS creation from wobjects. I really dig it, the demo ( http://demo.plainblack.com ) really *does not* do it justice, even though it's still pretty neat. Keep in mind the demo is running the beta, so there will be some stuff that's broken. -DJCP -Original Message- From: [EMAIL PROTECTED] [mailto:[EMAIL PROTECTED] On Behalf Of Stephen A. Jarjoura Sent: Friday, March 11, 2005 11:50 PM To: boston-pm@mail.pm.org Subject: [Boston.pm] advocacy, et al. The prospect of wading through tons of OO PHP code in order to customize a CMS is disheartening. Having to learn Python just to use some of the great Python based CMS's is even more depressing. I just wanted an easy to use, easy to
Re: [Boston.pm] why popularity matters
On Thu, 2005-03-03 at 09:56 -0500, Adam Turoff wrote: On Thu, Mar 03, 2005 at 03:39:04AM -0500, Tom Metro wrote: For me, popularity matters for two reasons: 1. If you like Perl enough that you'd like it to be all or a big part of your day job. If Perl per se matters to you that much, then you should find some way to make it your day job. Find a new employer, start your own business, whatever it takes. s/Perl/(Bike Riding|Gardening|Cooking|Painting|Teaching|Filmmaking)/; as appropriate. There is nothing magical about Perl programming that makes it so very different than other pursuit. OK. But by that logic it's still a win for Perl to be more popular. For example, in areas where bike riding is more popular, there tends to be more bike paths, good bike shops, etc. Look, here's the thing that weirds me out the most about these threads. You are a member of Perl Mongers. A group intended for Perl enthusiasts. A place for people who really like Perl to gather, exchange ideas, etc. It really blows my mind that some people on this list seem really interested in shooting down even the idea of trying to make Perl more popular. I would expect some differences in opinions on what ways might be more effective. That some people would be more interested in seeing/helping with idea B than idea A. But I can't get my mind around WHY the very _concept_ of trying to grow Perl seems so awful to some. Particularly on a list like Boston.pm. Why are you here if you think Perl _should_ fade into obscurity? Maybe I'm getting the wrong impression, but if that's the way you feel, beat the curve - leave. What are you afraid of?!?! If Perl per se matters to you that much, then you should find some way to make it your day job. Find a new employer, start your own business, whatever it takes. What the heck do you think we're trying to do? We're just looking for a way to help all of us collectively. Maybe some of the ideas that have been proposed aren't great. Maybe they will work, maybe not. But if we can't even hold a positive discussion among ourselves about ways we might be able to help Perl grow (_beyond_ the old standard responses we all know by rote - contribute to CPAN, add docs, test, yada yada), then maybe Perl is done, since without a supportive community it is doomed. -- Sean Quinlan [EMAIL PROTECTED] signature.asc Description: This is a digitally signed message part ___ Boston-pm mailing list Boston-pm@mail.pm.org http://mail.pm.org/mailman/listinfo/boston-pm
Re: [Boston.pm] why popularity matters
On Thu, 2005-03-03 at 10:59 -0500, Adam Turoff wrote: Discuss advocacy and popularity at the expense of building cool tools with Perl. Huh?!? Sorry Adam, but WTF? Who ever said that building cools tools isn't important. I would certainly agree that it is, and indeed more important. I'm saying what else can we do AS WELL! You don't like advocacy? Fine. You said so (well, sort of), and leave those of us who might alone to brainstorm and see if any new or useful ideas come up. It's our time, NOT yours. Case in point: Yesterday, I picked up a copy of Markdown. It's really god-awful Perl code, but it does something very important to me: convert a plain text format into reasonable HTML. I don't care that it's not on CPAN. I don't care that it's a hack. I want something that helps me write quick a few little docs without starting Word, dusting off DocBook or firing up [La]TeX. Gee whiz! Good for you! -- Sean Quinlan [EMAIL PROTECTED] signature.asc Description: This is a digitally signed message part ___ Boston-pm mailing list Boston-pm@mail.pm.org http://mail.pm.org/mailman/listinfo/boston-pm
Re: [Boston.pm] (also) Perl
On Mon, 2005-02-28 at 11:16 -0500, Adam Turoff wrote: The number of Perl job openings today, during the boom, or during the bust is largely irrelevant. Java was supposed to be the programming languages to end all programming languages. It wasn't then, and it isn't now. Interestingly, the whole Java community seems to be slowly awaking from it's overcomplexification of programming, and developing lightweight systems (the kind of stuff that's natural to write with Perl). And Perl certainly is also not the end all and be all of programming languages. Over time, we've seen legacy systems ditched for Perl reimplementations, and Perl systems ditched for PHP, Java, C#, C, and other reimplementations. It's all cyclical. If Perl makes it easy to solve problems, it'll win. If not, it deserves a lesser status. Same as any other technology from Assembly Language to Z-machines. This is also a gross over-simplification, and quite naive IMHO. Although it a great geek ideal that the best tech will always win in the end, it just isn't so. Sure, it makes a difference, but my observation is that that just isn't the only factor. Maybe not even the biggest. Most of the arguments I'm seeing against certification seem to me to smack of elitism. PHB's unfortunately don't usually make decisions primarily on real technical merit. They only know oversimplified catch phrases about languages, and make many decisions based on the cover-my-ass principle of middle management. I've had a number of my own battles with this type of manager, who would choose to hire two Java programmers and spend six months developing a web site for loading and accessing some basic data that could have been done by just one Perl programmer, probably in a month or two less. They made that decision because it was safer, because they had a head full of negative myth's about Perl. THAT is why some of us are considering certification. Not because it will make Perl better, or guarantee good programmers, but because it will give PHB's something to hold on to. Look Perl has matured, it has coding standards now, there is a certification program. Maybe you care most if that's all bullshit. I certainly wouldn't blame you or say that it's not. I wish we lived in that ideal world where the best tech always wins on pure merit alone. But we don't. I'm not interested in going out and shouting from rooftops how cool Perl is. It would likely hurt more than help. I am interested in discussing ways we can increase exposure in a way that does not alienate the market, ways to increase the acceptability of Perl as a possible solution the those decision makers who don't really know squat about Perl. If you have other suggestions on how we might do that, I'd love to hear them. -- Sean Quinlan [EMAIL PROTECTED] signature.asc Description: This is a digitally signed message part ___ Boston-pm mailing list Boston-pm@mail.pm.org http://mail.pm.org/mailman/listinfo/boston-pm
Re: [Boston.pm] GUI builders, support tools
On Mon, 2005-02-28 at 16:39 -0500, Tom Metro wrote: I was skeptical that such things actually added to one's programming efficiency. My friend wasn't an IDE junkie. He spent plenty of years working on the command line and with text editors. His opinion was that these bits of automation really did help, and the lack of them in Komodo made it seem way behind the curve. Most long time Perl programmers will scoff at IDEs, but the lack of tools is part of the problem of Perl not being accepted by the corporate IT community. Of course it is also a catch-22. Without a critical mass of users, there isn't a financial incentive for companies to develop such tools. Whether open source plug-ins for Eclipse can bridge the gap, who knows. (Thanks to Duane Bronson for mentioning that there is a Perl plug-in for Eclipse. I had been wondering, and asked a few people, but wasn't aware that it existed.) After learning Quanta for web development I'm much more interested in looking at improved coding tool for Perl. I've played with Eclipse a little, and intend to get back to it when I have a a couple tuits. I'm not interested in WYSIWYG editors. But here's something you basic text editor doesn't give you that I think Eclipse does. Function jumping (or whatever it's called). I'd _LOVE_ to be able to click (or highlight and meta-somthing, whatever) on a function or method call and have the editor skip directly to it's definition - even if it is from another module and had to go find it! -- Sean Quinlan [EMAIL PROTECTED] signature.asc Description: This is a digitally signed message part ___ Boston-pm mailing list Boston-pm@mail.pm.org http://mail.pm.org/mailman/listinfo/boston-pm
Re: [Boston.pm] (also) Perl
On Sun, 2005-02-27 at 10:27 -0500, Ian Langworth wrote: On 27.Feb.2005 10:14AM -0500, Greg London wrote: When IS perl 6 going to be ready, anyway? Christmas. All I want for Christmas is my ... ;) -- Sean Quinlan [EMAIL PROTECTED] signature.asc Description: This is a digitally signed message part ___ Boston-pm mailing list Boston-pm@mail.pm.org http://mail.pm.org/mailman/listinfo/boston-pm
Re: [Boston.pm] (also) Perl
On Sat, 2005-02-26 at 10:28 -0500, Uri Guttman wrote: JT If I could write standalone programs for windows in perl, and be JT able to share those programs with my non-perl collegues at work JT without over head of them having to install perl separately, would JT work wonders for general acceptance of the language. I understand JT that I can bundled perl itself as an executable. But the WYSIWYG JT IDE and easy to use executables just seem to make the language JT more palatable for knowledgeable, non-technical users. there are several cross platform gui libs for perl. the ones that come to mind are perl/tk, wx (was wxwindows) and perl/qt. i think perl/gtk is also around. and there is at least one gui editor called glade and i think there are others. you just have to look around cpan and the net for these. they don't come with perl nor are there one primary standard way (timtowtdi as always). then you can have your eyecandy and such while also using perl. The windows libs for Qt 4 ( http://www.trolltech.com/ ) are now free for open source projects. The Qt development tools came with my SuSE dist and I've played with them some. You can assemble all the GUI parts in the Qt builder and then execute a script that converts the Qt project to Perl modules which was really nice. And Mandrake Linux has been using Perl with the Gtk binding to make a lot of their administrative tools. There's an article about it on www.perl.com. GL -- Sean Quinlan [EMAIL PROTECTED] signature.asc Description: This is a digitally signed message part ___ Boston-pm mailing list Boston-pm@mail.pm.org http://mail.pm.org/mailman/listinfo/boston-pm
Re: [Boston.pm] (also) Perl
On Fri, 2005-02-25 at 16:23 -0500, Andres Monroy-Hernandez wrote: If any, I think O'Reilly should be the issuer of those certificates. I think it would be a nice thing to have for marketing purposes as others have pointed out. Maybe. If not the issuer I'd like to involve them. Not just for advice about certifications in general and perhaps start-up assistance, but if they don't issue it, they should certainly get the opportunity to publish a certification training book as soon as we're up and running! ;) Another idea would be to use the PerlMonks ranking number as certificates :-) Nah. I'm a monk now, mostly just for being a regular lurker. :) -- Sean Quinlan [EMAIL PROTECTED] signature.asc Description: This is a digitally signed message part ___ Boston-pm mailing list Boston-pm@mail.pm.org http://mail.pm.org/mailman/listinfo/boston-pm
Re: [Boston.pm] (also) Perl
On Fri, 2005-02-25 at 15:07 -0600, Alex Brelsfoard wrote: I like this idea. I think Perl certification WOULD make the world happier. Then again, I like Greg's idea. Think maybe some of us PerlMongers could get together and actually start up a real Perl certification program? I don't see why not. However for acceptance by PHB's it would need to be a bit more ... organized than just being a casual mongers program. But I think the Perl mongers, YAS/Perl Foundation, O'Reily, and perhaps others should be involved if possible, at least in an advisory role. The certification should definitely meet our high standards! ;) Sexy, sexy LAMP certification? :P I think this is an excellent addition to the planned topic's for our next tech meeting. Which we still haven't scheduled. It looks like the second Tuesday wont actually be a conflict for me through the spring if people want to stick to that schedule? -- Sean Quinlan [EMAIL PROTECTED] signature.asc Description: This is a digitally signed message part ___ Boston-pm mailing list Boston-pm@mail.pm.org http://mail.pm.org/mailman/listinfo/boston-pm
Re: [Boston.pm] Social Meeting Plans Tech Meeting Followup
On Wed, 2005-02-09 at 12:08, Ronald J Kimball wrote: We'd like to have a social meeting tomorrow night while brian is still in town. Let's get suggestions for a location; somewhere convenient to the T. We're not going to let a little snow stop us from having a good time! Central Sq. this time? Phoenix Landing? Back to John Harvard's? ... Anyplace good by North Station these days? Also I found a black knit cap that someone left behind at the meeting. -- A time comes when silence is betrayal. Even when pressed by the demands of inner truth, men do not easily assume the task of opposing their government's policy, especially in time of war. Nor does the human spirit move without great difficulty against all the apathy of conformist thought, within one's own bosom and in the surrounding world. - Martin Luther King Jr. signature.asc Description: This is a digitally signed message part ___ Boston-pm mailing list Boston-pm@mail.pm.org http://mail.pm.org/mailman/listinfo/boston-pm
[Boston.pm] search.cpan.org gone?
I just tried to search cpan at search.cpan.org (looking to check out mod_parrot, which might not even _be_ on CPAN now that I think about it), and got 502 bad gateway? -- Sean Patrick Quinlan [EMAIL PROTECTED] Tired of spyware? Whish there was a better, more secure way to browse the internet? There is, Firefox! And it's free! http://www.getfirefox.com signature.asc Description: This is a digitally signed message part ___ Boston-pm mailing list Boston-pm@mail.pm.org http://mail.pm.org/mailman/listinfo/boston-pm
Re: [Boston.pm] When will the Jan meeting be?
On Fri, 2004-12-31 at 11:43, Ronald J Kimball wrote: Sorry for the inconvenience! If we can quickly select an alternate day for Jan I'll try to get it scheduled ASAP. How about a technical meeting on Tuesday, Jan 25? Meanwhile, we can discuss what day would be best for future meetings. OK, I'll find us a room for the 25th. After some negotiation, we have agreed upon the 19th of January, 2005, being a Wednesday. Now we just need to decide upon a location. I'd favor somewhere we don't usually go to (i.e. not Boston Beer Works or Cambridge Brewing Company). LMAO! Well, I think Uri suggested FireIce in Harvard Sq., which is certainly someplace new. Parking in Harvard is the pits, but access by T is good and parking can be found free or cheap around Davis Sq. or at Alewife if you have to drive and don't want to face Harvard. Non-Harvard alternates in Kenmore Sq. are Bertuchi's and Uno's. -- Sean Quinlan [EMAIL PROTECTED] ___ Boston-pm mailing list Boston-pm@mail.pm.org http://mail.pm.org/mailman/listinfo/boston-pm
Re: [Boston.pm] When will the Jan meeting be?
Well, I still haven't heard from Ronald about long term arrangements (hopefully everything is OK!?), so I'll bring this up with the list. Unfortunately I have acquired a new ongoing commitment which will regularly conflict with the second Tuesday of the month (our usual tech meeting day). I'd be more than happy to continue arranging a room at BU, but we would need to either move the meetings to the first or last Tue of every month or to a different day. Otherwise we will need to find a new location for our tech meetings. Sorry for the inconvenience! If we can quickly select an alternate day for Jan I'll try to get it scheduled ASAP. In honor of Ben's visit I hereby propose a social event for Sun the 19th of Jan at say 7pm. any interesting new suggestions for a location? Given the season the closer to a T station the better. And of course a good beer selection is required! ;-} -- Sean Quinlan [EMAIL PROTECTED] signature.asc Description: This is a digitally signed message part ___ Boston-pm mailing list Boston-pm@mail.pm.org http://mail.pm.org/mailman/listinfo/boston-pm
Re: [Boston.pm] When will the Jan meeting be?
On Fri, 2004-12-31 at 02:05, Ben Tilly wrote: Sunday? (Checks quickly.) I'll try to make the next Sun the 19th of Jan in 2014 if I'm around. DOH! Right my calendar is still on Dec. That's my cue I should have been off to bed a while ago! :) In the meantime I'd love to make Thu the 19th of Jan in 2005 at, say, 7 pm... ;-) How about Wed the 19th of Jan 2005? ;-} Of course, at this point I can't be certain of much obviously, but at least we've gotten started! -- Sean Quinlan [EMAIL PROTECTED] signature.asc Description: This is a digitally signed message part ___ Boston-pm mailing list Boston-pm@mail.pm.org http://mail.pm.org/mailman/listinfo/boston-pm
Re: [Boston.pm] When will the Jan meeting be?
Ronald, I've sent you a few emails over the last couple weeks about this, have you not received them? They don't seem to have been returned. On Tue, 2004-12-28 at 13:01, Ronald J Kimball wrote: On Sun, Dec 19, 2004 at 11:35:45PM -0800, Ben Tilly wrote: As I said before, I'll be in Boston for part of January. January 19 would be particularly convenient for me to meet with Boston.pm people. If it is another time I could try to make it (but probably won't succeed). But I'll need a basic plan soonish because my access to a computer will be spotty through January. I just realized that we don't have a date reserved at BU for the January meeting. Ben, would you prefer meeting people at a social meeting or a technical meeting? Ronald ___ Boston-pm mailing list Boston-pm@mail.pm.org http://mail.pm.org/mailman/listinfo/boston-pm -- Sean Quinlan [EMAIL PROTECTED] signature.asc Description: This is a digitally signed message part ___ Boston-pm mailing list Boston-pm@mail.pm.org http://mail.pm.org/mailman/listinfo/boston-pm
Re: [Boston.pm] OT: Recommendation for mail server?
On Thu, 2004-12-02 at 19:48, Ranga Nathan wrote: I am strongly advocating someone to get off Microsoft Exchange and move to a Linux based mail server. I have used Sendmail but I find it a bit complex . There has been more than enough discussion about options for replacing Exchange as just a mail server. But I'll trow my suggestion in too of course, regardless! ;-} Colo Hosting is so cheap these days, if mail is all you want, I'd recommend considering just spending the $60-$100/year and let someone else manage your mail server. I use site5.com and am very happy with them. Unlimited email addresses, webmail POP, plenty of bandwidth, unlimited mailing lists, forwarders, autoresponders, etc. If your really looking for a replacement to Exhange and all or most of it's services I'd recommend looking into SuSE's (now Novell's) OpenExchange server. http://www.novell.com/products/openexchange/ Getting the full product may be more money than they want to spend, but it's a full Linux replacement. Actually, IIRC, it offers even more than MS Exchange; I have no direct experience to compare ease of maintenance/use unfortunately. SuSE offered extremely deep discounts for educational/non-profit licenses, not sure if Novell does. There is also an open source product which IIRC started as an earlier version of SuSE's OpenExchange and was open sourced after Novell bought SuSE and started forking that version, I assume to have it start working with Novell's other server/collaboration tools. http://mirror.open-xchange.org/ox/EN/community/ HTH -- Sean Quinlan [EMAIL PROTECTED] gpg public-key http://grendels-den.org/sean.asc If ye love wealth better than liberty, the tranquility of servitude better than the animating contest of freedom, go home from us in peace. We ask not your counsels or arms. Crouch down and lick the hands which feed you. May your chains set lightly upon you, and may posterity forget that ye were our countrymen. Samuel Adams, 1776 -BEGIN GEEK CODE BLOCK- Version: 3.1 GIT/S/O d+@ s-:+ a C++ UL++$ P$ L++$ !E W++ N+ o? K? w O M V PS++ PE Y+ GPG++ t+ 5++ X+ R(++) tv b+(+++) DI+ D+ G e h r+++ y* --END GEEK CODE BLOCK-- signature.asc Description: This is a digitally signed message part ___ Boston-pm mailing list [EMAIL PROTECTED] http://mail.pm.org/mailman/listinfo/boston-pm
[Boston.pm] OT: Anyone with experience with DB's other than MySQL?
Good day, I'm nearly done with initial pass on porting the MySQL::Backup module to DBA::Backup and DBA::Backup::mysql. Then of course comes debugging and discovering all the things I broke. ;-} One of the pieces I just finished in the main run method, which really initiates all the work. It needs to sensibly order all the possible actions, even if some database extensions never call for them (via the conf). For example, I have an option for locking the database(s) up front as soon as it's a particular servers turn to be backed up. In the MySQL extension I wont use that action, instead choosing to lock the database(s) one at a time when I dump them. [let's leave discussing the pro's and con's of that to a separate thread] I've added possible actions for things like stopping and starting servers, etc. If anyone here backs up other server types (particularly PostgreSQL), I'd appreciate it if you could list the common steps you take. I don't think I need to many details at this point, just the order things are generally done in, including the preferred order of log backups in relation to databases (since Backup.pm generally backs up logs daily but DB's only when specified, once a week by default). Thanks!, -- Sean Quinlan [EMAIL PROTECTED] signature.asc Description: This is a digitally signed message part ___ Boston-pm mailing list [EMAIL PROTECTED] http://mail.pm.org/mailman/listinfo/boston-pm
[Boston.pm] kerberos and ph
OK, I've gotten thoroughly annoyed. I have come for help. I have an application which I would like to have use kerberos and ph. For kerberos all I need is to authenticate a username and password against a remote server. I would then like to use ph to get information about the user once validated. It looked like there were some useful krb5 modules on CPAN, but I haven't been able to get any to build. It appears they all want kerberos to be installed (and perhaps running) on the machine you are building the module on. I've been reading the krb5 docs considering making a local install and just not starting the system, but that looks like a nightmare too. So I thought I'd start at home. Does anyone here have experience successfully using either krb5 or ph from Perl? If so, could you let me know which module(s) you used, if you interfaced with the command line, or whatever you did to get it working? Until then, back to reading docs and watching make blow up. =/ lol Thanks, -- Sean Quinlan [EMAIL PROTECTED] ___ Boston-pm mailing list [EMAIL PROTECTED] http://mail.pm.org/mailman/listinfo/boston-pm
Re: [Boston.pm] emergency social meeting
I'm busy Tuesday night and can't reschedule. Any chance for Mon or Wed instead? On Fri, 2004-11-12 at 10:26, Uri Guttman wrote: bdf == brian d foy [EMAIL PROTECTED] writes: bdf I'm in Boston from Nov 15-18. brian d foy wants to hang with boston.pm some night next week. i mentioned this a little while ago but nothing happened so it is time to get it scheduled. how is next tuesday, nov 16 at 7pm? we could meet at the steakhouse BEHIND legal's on rte 9 (i was told it was decent with no waiting). i don't know how mobile or boston road aware brian is, so we could also meet in town if that works out. for those of you who don't know, bdf teaches for stonehenge (randal's biz) and is the founder of perl mongers (which you are a member of!) so let's give him his due props with a nice emergency social meeting. uri -- Sean Quinlan [EMAIL PROTECTED] signature.asc Description: This is a digitally signed message part ___ Boston-pm mailing list [EMAIL PROTECTED] http://mail.pm.org/mailman/listinfo/boston-pm
Re: [Boston.pm] Re: [Boston.pm-announce] Tech Meeting Tuesday, November 9
On Fri, 2004-10-22 at 00:12, Uri Guttman wrote: brian d foy wrote to me the other day and said he will be in town from Nov 15-18 and he wants to do something with us. so could we move the meeting back a week for that? if not we could plan a social meeting. Given how much trouble I've had this fall getting the rooms scheduled, I doubt I could get the room rescheduled in time at this point unfortunately. If someone else can offer a room somewhere while Brian is in town we could simply cancel (or not use) the BU room. Social meetings are always good as well. :) -- Sean Quinlan [EMAIL PROTECTED] signature.asc Description: This is a digitally signed message part ___ Boston-pm mailing list [EMAIL PROTECTED] http://mail.pm.org/mailman/listinfo/boston-pm
Re: [Boston.pm] Tech/Social Meeting w/ Randal Schwartz
On Sat, 2004-09-18 at 09:54, Ian Langworth wrote: My votes, in order, 1. Web-testing 2. Spamfighting Though, Randal, I would love to pick your brane about testing, teaching writing about Perl :-) Aye! I'm trying to get up the nerve to write an article on the WD repeat protein prediction program I presented on last spring. -- Sean Quinlan [EMAIL PROTECTED] signature.asc Description: This is a digitally signed message part ___ Boston-pm mailing list [EMAIL PROTECTED] http://mail.pm.org/mailman/listinfo/boston-pm
Re: [Boston.pm] Inheriting documentation for inherited command-line options
On Wed, 2004-09-08 at 10:34, Aaron Sherman wrote: On Wed, 2004-09-08 at 00:17, Uri Guttman wrote: use warnings should be here too. [...] i like _$method better. [...] i don't like using = like that. Uri, you're ripping the guy's code to shreds over minor points of syntactic sugar... I seem to remember that Perl's moto isn't There's only one way to do it. I think perhaps Uri is channeling the old tech meetings, where the main portion of the gathering was in-depth code review, including traps and common syntax. And I don't think anyone has accused Uri of being the most diplomatic monger. =P i can't get into the actual design or debugging but i hope my comments are useful. He did ask for help specifically in two areas of the design, not a style lecture. Usually I'm not this harsh, but man, that's gotta make a guy feel like sending his code to this list is about the same as pulling his pants down in public! While making recommendations on style can be useful, particularly in the cases where it can reduce the possibility of bugs, I would agree that approaching the main request of the poster first might be more appropriate. -- Sean Quinlan [EMAIL PROTECTED] ___ Boston-pm mailing list [EMAIL PROTECTED] http://mail.pm.org/mailman/listinfo/boston-pm
Re: [Boston.pm] Looking for a hosting service
Ted, I'm using Site5 ATM for a small project. http://site5.com/ Very good rates for what you get, including full CGI, MySQL and SSH access. However the 'jail' shell you get when you log in is very restrictive, so installing and setting up things is basically the equivalent of working only in your home directory. They were recommended by an associate who has used them for a couple years, and so far I have been very happy with their service responsiveness. There's also pair.net of course, which is _very_ highly recommended, but I think targets larger more customized sites. They cost about twice as much with fewer pre-packaged features. On Tue, 2004-09-07 at 10:56, [EMAIL PROTECTED] wrote: Hello Boston Perl people, I have a personal project, involving your basic LAMP suite of software, that also makes use of the Festival speech synthesis program to create mp3 files. My system also avails itself of RSS feeds, and thus, I use a full bucket of various Perl XML modules. I would like to begin tentatively establishing a web presence, with an aim towards soliciting user feedback. I'm thinking that I need to subscribe to a hosting system, that will be flexibile enough to allow me to install and configure Festival. Plus, I suppose that down the line, I'll want the kind of capability offerred by Icecast. My ideal situation would be a nice robust UNIX system, that I could subscribe to, and that gave me enough leeway to install and configure my own software, and where I could offer some of my finished product, at no cost, to gather user feedback. I am of course, looking for a bargain, since my project is not a money maker, at this point. But I feel that I need to take this sort of step, to take my project to the next level. I currently have one of thouse 100 mb Apple accounts, where I've been placing my samples, but I'd like to get significantly more storage, plus the CGI capability, in an cost-effective way. Thanks in advance, Ted Gilchrist ___ Boston-pm mailing list [EMAIL PROTECTED] http://mail.pm.org/mailman/listinfo/boston-pm -- Sean Quinlan [EMAIL PROTECTED] ___ Boston-pm mailing list [EMAIL PROTECTED] http://mail.pm.org/mailman/listinfo/boston-pm
Re: [Boston.pm] Re: Uploading a picture with perl
On Mon, 2004-08-02 at 19:32, Alex Brelsfoard wrote: Ron, Sean, Thank you both. I will give it a try. Sean, no worries, I have a two-layered security system in place, and plenty of well-placed warnings. I'm perfectly happy using CGI.pm (and am currently on this project). But I am a bit curious to know if there is a way to do this without using CGI.pm. Of course you _can_ do it without CGI.pm. But why would you? It's probably one of the most broadly used modules from CPAN. Very well tested and stable. That being said, there are many things it _can_ do that I don't usually use it for. Like generating the CGI forms (I was writing HTML before Perl, so it's just easier for me to print HTML;). But for anything remotely complex (getting form args, file uploads, etc.), I'll gladly let the CGI.pm maintainers (bless their souls) keep up with the latest standards best practices. Now, I think someone mentioned mod_perl. mod_perl and CGI.pm are not, to the best of my knowledge, exclusive. All of my current projects are written as mod_perl modules (no actual directories or .cgi's needed! :), but I still use CGI.pm for some things ... laziness again I suppose. It works, I know the interface. -- Sean Quinlan [EMAIL PROTECTED] ___ Boston-pm mailing list [EMAIL PROTECTED] http://mail.pm.org/mailman/listinfo/boston-pm
Re: [Boston.pm] uploading a picture with perl
On Mon, 2004-08-02 at 17:34, Alex Brelsfoard wrote:
open (UPLOAD, $filepath) || Error(Could not write $filepath);
while ($bytesread=read($picture,$buffer,1024))
{ print UPLOAD $buffer; }
close (UPLOAD);
$picture is the path to the picture on the user's system.
And how pray tell are you accessing the users system? ;-} And read()
wants an open file handle. You _are_ using strict and warnings, right?
Assuming your using CGI.pm (and you really do want to for this sort of
thing, IMHO) all you should need to add to your CGI is:
use CGI qw(:standard);
my $cgi = new CGI;
my $picture = $cgi-upload('forms_file_field_name');
Error(no file?) unless defined $picture; # your Error
just before the code you have above.
$filepath is the full path (including filename) to the file I would like
to write.
I'm doing this from a windows XP desktop to a RedHat 9 server.
The file will be created, but it is a zero-byte file. Strange that it can
create the file, but not put any content into it. Must be having problems
reading the file from the desktop.
Not strange at all. Looks like you had no problem creating the file, but
I think you weren't reading in any data. HTH
--
Sean Quinlan [EMAIL PROTECTED]
___
Boston-pm mailing list
[EMAIL PROTECTED]
http://mail.pm.org/mailman/listinfo/boston-pm
Re: [Boston.pm] Tech Meeting Followup
On Wed, 2004-06-16 at 07:59, Uri Guttman wrote: i did and he is also giving sufficiently advanced tech so we may not want to see that again in boston. But what % of the regular Boston.pm tech meeting attenders are actually _at_ YAPC? -- Sean Quinlan [EMAIL PROTECTED] signature.asc Description: This is a digitally signed message part ___ Boston-pm mailing list [EMAIL PROTECTED] http://mail.pm.org/mailman/listinfo/boston-pm
Re: [Boston.pm] What to do at tonight's meeting?
Really sorry I couldn't make it last night! :( Hope y'all had fun! -- Sean Quinlan [EMAIL PROTECTED] signature.asc Description: This is a digitally signed message part ___ Boston-pm mailing list [EMAIL PROTECTED] http://mail.pm.org/mailman/listinfo/boston-pm
RE: [Boston.pm] list viruses
On Thu, 2004-05-06 at 22:27, Bob Rogers wrote: From: Sean Quinlan [EMAIL PROTECTED] Date: Thu, 06 May 2004 11:13:43 -0400 . . . I also digitally sign my emails, which I wish more people took advantage of. I don't know of a virus yet that can fake a gpg signature . . . The virus wouldn't have to fake it. There is nothing that prevents a virus author from creating a valid key for a fictitious individual and signing the initial virus message. You wouldn't be able to find the key, because it wouldn't exist on any key server (putting it there might give away the identity of the author), so you could never prove that it wasn't valid. Which is why I believe I mentioned in one of my posts all of this is moot unless you can verify the signature. Which requires contacting them directly at some point, or trusting someone who has signed my key already. So there's a chicken-and-egg problem here: Validating signatures is not very useful, which makes signing not very useful, Except it brings up occasional discussions about it, which I think is useful. ;-} And a few friends and co-workers also use it. Of course I'd like to add an outgoing filter that automatically encrypts emails that are being sent directly to someone I have a key for too. ... Just cause :) which means there aren't many signatures to validate. Which in turn is probably why virus authors don't bother to fake signatures; I suspect most virus victims have never even seen a signed email. But all that may be a good thing; it will postpone the day when people set their passphrase cache lifetime to 10 years and let viruses sign away the value of their private keys. If and when that happens, and it might be inevitable, it will dilute the value of digital signatures generally, which will not be a good thing. I admit that I currently do cache my passphrase. A habit of laziness I know I'll need to give up once someone writes a virus that uses my MUA to generate outgoing email. However, since Evolution isn't automatically executing anything in emails I receive, I'm hoping that day will be a long way off. Hey yeah. BTW, anyone want to get to the next meeting early and do some key signing? Now *that* would be a good thing. =D P.S. I'm having a strong sense of deja vu now; have I sent this post before? Perhaps in a previous life? Or a different list? -- Sean Quinlan [EMAIL PROTECTED] ___ Boston-pm mailing list [EMAIL PROTECTED] http://mail.pm.org/mailman/listinfo/boston-pm
RE: [Boston.pm] list viruses
Wow, a debate! ;-} On Thu, 2004-05-06 at 10:36, Tolkin, Steve wrote: I almost never open an attachment, unless it comes from a known and trusted source, and I am expecting an attachment. This is an antivirus measure. I agree in the general concept of hesitating. However, reading the email usually, IMHO, makes it fairly plain if an attachment is intended to be there by the sender; particularly to a list like this, where the contents of the attachment are discussed in the email. Of course, I'm also reading my email on a Linux box. While this is certainly not risk free, I am much less worried about email viruses - if I'm unsure about an email I just view the source and review the attachment as is before deciding on an action. I also digitally sign my emails, which I wish more people took advantage of. I don't know of a virus yet that can fake a gpg signature. If my key isn't trusted by you and your interested in my attachment, you could always just contact me directly for verification (of either the attachment or the key). Hey yeah. BTW, anyone want to get to the next meeting early and do some key signing? So unfortunately I never get to read the posts certain by certain people, e.g. Sean Quinlan, because for some reason their posts become an attachment. Because I choose to make it an attachment. Personally I find this far preferable. I like being able to save attachments to a file if I want to play with it without having to do any cutting and pasting; particularly since email programs have a bad habit of mangling code. And my email client allows me the option of viewing text attachments in-line if I want to scan it first. Again, this is just my 2 cents. I'm sorry you don't get to look at my code (assuming of course anyone is actually interested in the first place! =P ). Frankly though, if I have to go open it in an editor and cut and paste entire programs into my emails, you probably wont ever see it anyway unfortunately. Thanks, -- Sean Quinlan [EMAIL PROTECTED] ___ Boston-pm mailing list [EMAIL PROTECTED] http://mail.pm.org/mailman/listinfo/boston-pm
[Boston.pm] digital signatures stripped?
Actually looking at my last few posts to this lists, it looks like the actual signature portion is getting stripped out? -- Sean Quinlan [EMAIL PROTECTED] ___ Boston-pm mailing list [EMAIL PROTECTED] http://mail.pm.org/mailman/listinfo/boston-pm
Re: [Boston.pm] digital signatures stripped?
On Thu, 2004-05-06 at 12:29, Ronald J Kimball wrote: On Thu, May 06, 2004 at 11:53:12AM -0400, Chris Devers wrote: On Thu, 6 May 2004, Sean Quinlan wrote: Actually looking at my last few posts to this lists, it looks like the actual signature portion is getting stripped out? Yep. This kind of thing is why no one signs list mail :-) I'll try to remember to not sign list posts - but no promises. Although I'm also skeptical of the utility of signing messages to mailing lists, it wasn't actually intentional that signatures be stripped. I just sign all my email by default. The only time I'd think it might be of real use on a list is for verifying attachments. Use of encryption is something I like to advocate though, if only in a small way by actually using it myself. :) I've added application/pgp-signature to the list of allowed attachment types. Thanks! -- Sean Quinlan [EMAIL PROTECTED] signature.asc Description: This is a digitally signed message part ___ Boston-pm mailing list [EMAIL PROTECTED] http://mail.pm.org/mailman/listinfo/boston-pm
Re: [Boston.pm] list viruses
On Thu, 2004-05-06 at 14:26, Dan Sugalski wrote: At 2:12 PM -0400 5/6/04, Richard Morse wrote: Mail (on Mac OS X) also shows Mr. Quinlan's messages Mr. Quinlan?!? =P as an odd attachment (which I never read, because I am very lazy). Oddly, the next message in this thread is from Mr. Quinlan where he notes he has heard of the problem before; it came through just fine. I'm trying to remember to not sign emails to the list; an unreliable prospect at best I'm afraid. His next one did not. I should note that Mail is retrieving the message from an Exchange server (which is not something that I can change). It happens with non-exchange servers as well. I'm running qmail and UW-IMAP with Eudora as a client, Et tu Eudora?!? sigh Does Eudora still provide a way to add a PGP plugin? OK, with three clients having problems it looks like I may need to work a bit harder to avoid signing list mails. Maybe an outgoing filter... and his messages are all noted as having several attachments. (Eudora, however, automatically inlines any plain text attachments, so I don't have to explicitly jump through hoops--they're jumped through for me :) Several attachments? Now that seems odd since there should only be one ... hmmm, there are some markers in the text which are maybe interpreted as separating attachments? Well, at least Eudora keeps it there so you can read it. -- Sean Quinlan [EMAIL PROTECTED] ___ Boston-pm mailing list [EMAIL PROTECTED] http://mail.pm.org/mailman/listinfo/boston-pm
[Boston.pm] WD repeat prediciton
Just in case anyone is curious, I've attached the wd repeat prediction
tool a presented last night. It needs a little cleanup to have the
docs finished, but it's fully functional. Any feedback is always
welcome.
The input files are in the format:
ID\tsequence\n
I've also attached a sample sequence file with a small set of sequences
a few of which should be predicted to contain WD repeats.
Thanks to everyone who made it out last night!
--
Sean Quinlan [EMAIL PROTECTED]
#!/usr/bin/perl
=head1 NAME
wd_search
=head1 SYNOPSIS
Seaches a tab delimited file containing amino acid sequences and predicts
which probably contain WD repeat domains.
shell wd_search yeast_aa.tsv
shell wd_search yeast_aa.tsv -min 3 -turn 30
=head1 DESCRIPTION
=cut
use warnings; # comment this out to have warnings only active in debugging
use strict;
use Benchmark;
our $VERSION = '0.1';
# this program requires arguments, so if we got none give a polite exit
unless (defined $ARGV[0]){
basic_usage;
exit;
} # brief help syntax
use Getopt::Long;
my %params = ();
# allows - in command args to indicate input from stdin (console or pipe)
# my $stdin = ''; # add this to GetOptions call: '' = \$stdin
my $result = GetOptions(\%params,'help|h','d+','v','Dmod=f','Hmod=f','floor=i',
'min=i', 'turn_max=i');
# if help or version information requested, there's no need to go on
if ($params{help}) { exec perldoc $0 }
elsif ($params{v}){
basic_usage;
exit;
} # brief help syntax
# determine if we're debugging
my $debug = $params{d} || 0;
# uncomment the following to have warnings turned on only when debugging
#$^W++ if $debug;
require diagnostics import diagnostics if $debug = 3;
$| = 1; # because I am inherently impatient
# Add any other initial set up here
my $t0 = new Benchmark;
my $floor = $params{floor} || -3;
my $turn_len = $params{turn_max} || 22;
my $min_rep_scr = $params{min} || 6;
my $min_flanked_repeat = $min_rep_scr / 3;
my $strong_wd_score = $min_rep_scr * 2;
$params{Hmod} ||= 1.1;
my $AR_mat1 = mat1;
foreach my $aa (keys %{$AR_mat1-[1]}) { $AR_mat1-[1]{$aa} *= $params{Hmod} }
$params{Dmod} ||= 1.2;
my $AR_mat2 = mat2;
foreach my $aa (keys %{$AR_mat2-[7]}) { $AR_mat2-[7]{$aa} *= $params{Dmod} }
my ($HR_turn_aa,$HR_turn_pair) = turn_mats;
my $mat2_len = @{$AR_mat2}; # m2 is longer for wd repeats
# and the 'main' section here
while () {
chomp;
my @F = split;
$F[1] =~ s/[^ACDEFGHIKLMNPQRSTVWY]/A/g;
# calcualte turn regions (using thse from this output with length =4
my @seq = split(//,$F[1]);
# print Searching $F[0], $#seq aa long\n;
if ($debug) {
open(WD1, wd1.$F[0]) or die Couldn't write wd1 plot: $!;
open(TURN, turn.$F[0]) or die Couldn't write turn plot: $!;
open(WD2, wd2.$F[0]) or die Couldn't write wd2 plot: $!;
open(SUM, sum.$F[0]) or die Couldn't write wd2 plot: $!;
} # output plots if debugging
my $last_aa = $#seq - $mat2_len;
my @wd1 = my @wd2 = ();
my %turn = ();
my $floor_rep_cnt = 0;
foreach my $i (0 .. $last_aa) {
my $scr1 = 0;
foreach my $j (0 .. $#{$AR_mat1}) {
$scr1 += $$AR_mat1[$j]{$seq[$i+$j]};
} # foreach aa from this position
push(@wd1,[$i,$scr1]) if $scr1 $floor;
my $scr2 = 0;
foreach my $j (0 .. $#{$AR_mat2}) {
$scr2 += $$AR_mat2[$j]{$seq[$i+$j]};
} # foreach aa from this position
push(@wd2,$scr2);
if ($debug) {
$scr1 = $floor if $scr1 $floor;
$scr2 = $floor if $scr2 $floor;
print WD1 $i\t$scr1\n;
print WD2 $i\t$scr2\n;
} # if debugging
$floor_rep_cnt++ if $scr2 $floor; # too conservative?
} # scan the sequence
next unless $floor_rep_cnt = 3;
my @best_pairs = ();
foreach my $ARow (@wd1) {
my $i = $$ARow[0];
my @keep = ();
my $end = $i + $turn_len + 12;
$end = $last_aa if $end $last_aa;
my @match = ();
foreach my $j (($i + 14) .. $end) {
next unless $wd2[$j] $floor;
# calc turn score for this pair
my $pos1 = $i + 12;
my $pos2 = $j - 2; # why is this -2?
my $t_scr = $HR_turn_aa-{$seq[$pos1]}[1];
foreach my $k ($pos1 .. $pos2) {
# is there any 'real' information in the general turn siglet
# probs? Does removing this help bias scoring to short turns
#with a good pair?
#$t_scr += $HR_turn_aa-{$seq[$k]}[0] unless $k == $pos1;
my $pair = $seq[$k] . $seq[$k+1];
$t_scr += $HR_turn_pair-{$pair};
} # foreach position in potential turn
$t_scr += $HR_turn_aa-{$seq[$pos2+1]}[2];
if ($debug) {
print TURN $pos1\t$t_scr\n;
my $sum = $$ARow[1] + $wd2[$j] + $t_scr;
foreach my $k ($i .. $j + 15) {
print SUM $k\t$sum\n;
} # foreach position in possible repeat
} # debugging plot
# too conservative?
next unless $$ARow[1] + $wd2[$j] + $t_scr = 0;
push(@match,[$j,$wd2[$j],($$ARow[1] + $wd2[$j] + $t_scr)]);
} # for each position in allowed wd2 range
next unless @match;
push(@best_pairs,[$i,$$ARow[1],
@ {(sort {$$b[2] = $$a[2]} @match)[0]}]);
} # foreach decent hit in first half matrix
next
Re: [Boston.pm] WD repeat prediciton
Oops, looks like I forgot the seq file. On Wed, 2004-04-28 at 07:51, Sean Quinlan wrote: Just in case anyone is curious, I've attached the wd repeat prediction tool a presented last night. It needs a little cleanup to have the docs finished, but it's fully functional. Any feedback is always welcome. The input files are in the format: ID\tsequence\n I've also attached a sample sequence file with a small set of sequences a few of which should be predicted to contain WD repeats. Thanks to everyone who made it out last night! -- Sean Quinlan [EMAIL PROTECTED] YAL001CMVLTIYPDELVQIVSDKIASNKGKITLNQLWDISGKYFDLSDKKVKQFVLSCVILKKDIEVYCDGAITTKNVTDIIGDANHSYSVGITEDSLWTLLTGYTKKESTIGNSAFELLLEVAKSGEKGINTMDLAQVTGQDPRSVTGRIKKINHLLTSSQLIYKGHVVKQLKLKKFSHDGVDSNPYINIRDHLATIVEVVKRSKNGIRQIIDLKRELKFDKEKRLSKAFIAAIAWLDEKEYLKKVLVVSPKNPAIKIRCVKYVKDIPDSKGSPSFEYDSNSADEDSVSDSKAAFEDEDLVEGLDNFNATDLLQNQGLVMEEKEDAVKNEVLLNRFYPLQNQTYDIADKSGLKGISTMDVVNRITGKEFQRAFTKSSEYYLESVDKQKENTGGYRLFRIYDFEGKKKFFRLFTAQNFQKLTNAEDEISVPKGFDELGKSRTDLKTLNEDNFVALNNTVRFTTDSDGQDIFFWHGELKIPPNSKKTPNKNKRKRQVKNSTNASVAGNISNPKRIKLEQHVSTAQEPKSAEDSPSSNGGTVVKGKVVNFGGFSARSLRSLQRQRAILKVMNTIGGVAYLREQFYESVSKYMGSTTTLDKKTVRGDVDLMVESEKLGARTEPVSGRKIIFLPTVGEDAIQRYILKEKDSKKATFTDVIHDTEIYFFDQTEKNRFHRGKKSVERIRKFQNRQKNAKIKASDDAISKKSTSVNVSDGKIKRRDKKVSAGRTTVVVENTKEDKTVYHAGTKDGVQALIRAVVVTKSIKNEIMWDKITKLFPNNSLDNLKKKWTARRVRMGHSGWRAYVDKWKKMLVLAIKSEKISLRDVEELDLIKLLDIWTSFDEKEIKRPLFLYKNYEENRKKFTLVRDDTLTHSGNDLAMSSMIQREISSLKKTYTRKISASTKDLSKSQSDDYIRTVIRSILIESPSTTRNEIEALKNVGNESIDNVIMDMAKEKQIYLHGSKLECTDTLPDILENRGNYKDFGVAFQYRCKVNELLEAGNAIVINQEPSDISSWVLIDLISGELLNMDVIPMVRNVRPLTYTSRRFEIRTLTPPLIIYANSQTKLNTARKSAVKVPLGKPFSRLWVNGSGSIRPNIWKQVVTMVVNEIIFHPGITLSRLQSRCREVLSLHEISEICKWLLERQVLITTDFDGYWVNHNWYSIYEST YAL002WMEQNGLDHDSRSSIDTTINDTQKTFLEFRSYTQLSEKLAYTAPPLNEDGPKGVASAVSQGSESVVSWTTLTHVYSILGAYGGPTCLYPTATYFLMGTSKGCVLIFNYNEHLQTILVPTLSEDPSIHSIRSPVKSIVICSDGTHVAASYETGNICIWNLNVGYRVKPTSEPTNGMTPTPALPAVLHIDDHVNKEITGLDFFGARHTALIVSDRTGKVSLYNGYRRGFWQLVYNSKKILDVNSSKEKLIRSKLSPLISREKISTNLLSVLTTTHFALILLSPHVSLMFQETVEPSVQNSLVVNSSISWTQNCSRVAYSVNNKISVISISSSDFNVQSASHSPEFAESILSIQWIDQLLLGVLTISHQFLVLHPQHDFKILLRLDFLIHDLMIPPNKYFVISRRSFYLLTNYSFKIGKFVSWSDITLRHILKGDYLGALEFIESLLQPYCPLANLLKLDNNTEERTKQLMEPFYNLSLAALRFLIKKDNADYNRVYQLLMVVVRVLQQSSKKLDSIPSLDVFLEQGLEFFELKDNAVYFEVVANIVAQGSVTSISPVLFRSIIDYYAKEENLKVIEDLIIMLNPTTLDVDLAVKLCQKYNLFDLLIYIWNKIFDDYQTPVVDLIYRISNQSEKCVIFNGPQVPPETTIFDYVTYILTGRQYPQNLSISPSDKCSKIQRELSAFIFSGFSIKWPSNSNHKLYICENPEEEPAFPYFHLLLKSNPSRFLAMLNEVFEASLFNDDNDMVASVGEAELVSRQYVIDLLLDAMKDTGNSDNIRVLVAIFIATSISKYPQFIKVSNQALDCVVNTICSSRVQGIYEISQIALESLLPYYHSRTTENFILELKEKNFNKVLFHIYKSENKYASALSLILETKDIEKEYNTDIVSITDYILKKCPPGSLECGKVTEVIETNFDLLLSRIGIEKCVTIFSDFDYNLHQEILEVKNEETQQKYLDKLFSTPNINNKVDKRLRNLHIELNCKYKSKREMILWLNGTVLSNAESLQILDLLNQDSNFEAAAIIHERLESFNLAVRDLLSFIEQCLNEGKTNISTLLESLRRAFDDCNSAGTEKKSCWILLITFLITLYGKYPSHDERKDLCNKLLQEAFLGLVRSKSSSQKDSGGEFWEIMSSVLEHQDVILMKVQDLKQLLLNVFNTYKLERSLSELIQKIIEDSSQDLVQQYRKFLSEGWSIHTDDCEICGKKIWGAGLDPLLFLAWENVQRHQDMISVDLKTPLVIFKCHHGFHQTCLENLAQKPDEYSCLICQTESNPKIV YAL003WMASTDFSKIETLKQLNASLADKSYIEGTAVSQADVTVFKAFQSAYPEFSRWFNHIASKADEFDSFPAASDDDVDLFGSDDEEADAEAEKLKAERIAAYNAKKAAKPAKPAAKSIVTLDVKPWDDETNLEEMVANVKAIEMEGLTWGAHQFIPIGFGIKKLQINCVVEDDKVSLDDLQQSIEEDEDHVQSTDIAAMQKL YAL005CMSKAVGIDLGTTYSCVAHFANDRVDIIANDQGNRTTPSFVAFTDTERLIGDAAKNQAAMNPSNTVFDAKRLIGRNFNDPEVQADMKHFPFKLIDVDGKPQIQVEFKGETKNFTPEQISSMVLGKMKETAESYLGAKVNDAVVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKGKEEHVLIFDLGGGTFDVSLLFIEDGIFEVKATAGDTHLGGEDFDNRLVNHFIQEFKRKNKKDLSTNQRALRRLRTACERAKRTLSSSAQTSVEIDSLFEGIDFYTSITRARFEELCADLFRSTLDPVEKVLRDAKLDKSQVDEIVLVGGSTRIPKVQKLVTDYFNGKEPNRSINPDEAVAYGAAVQAAILTGDESSKTQDDVAPLSLGIETAGGVMTKLIPRNSTISTKKFEIFSTYADNQPGVLIQVFEGERAKTKDNNLLGKFELSGIPPAPRGVPQIEVTFDVDSNGILNVSAVEKGTGKSNKITITNDKGRLSKEDIEKMVAEAEKFKEEDEKESQRIASKNQLESIAYSLKNTISEAGDKLEQADKDTVTKKAEETISWLDSNTTASKEEFDDKLKELQDIANPIMSKLYQAGGAPGGAAGGAPGGFPGGAPPAPEAEGPTVEEVD YAL007CMIKSTIALPSFFIVLILALVNSVAASSSYAPVAISLPAFSKECLYYDMVTEDDSLAVGYQVLTGGNFEIDFDITAPDGSVITSEKQKKYSDFLLKSFGVGKYTFCFSNNYGTALKKVEITLEKEKTLTDEHEADVNNDDIIANNAVEEIDRNLNKITKTLNYLRAREWRNMSTVNSTESRLTWLSILIAVISIAQVLLIQFLFTGRQKNYV YAL008WMTLAFNMQRLVFRNLNVGKRMFKNVPLWRFNVANKLGKPLTRSVGLGGAGIVAGGFYLMNRQPSKLIFNDSLGAAVKQQGPLEPTVGNSTAITEERRNKISSHKQMFLGSLFGVVLGVTVAKISILFMYVGITSMLLCEWLRYKGWIRINLKNIKSVIVLKDVDLKKLLIDGLLGTEYMGFKVFFTLSFVLASLNANK YAL009WMEPESIGDVGNHAQDDSASIVSGPRRRSTSKTSSAKNIRNSSNISPASMIFRNLLILEDDLRRQAHEQKILKWQFTLFLASMAGVGAFTFYELYFTSDYVKGLHRVILQFTLSFISITVVLFHISGQYRRTIVIPRRFFTSTNKGIRQFNVKLVKVQSTWDEKYTDSVRFVSRTIAYCNIYCLKKFLWLKDDNAIVKFWKSVTIQSQPRIGAVDVKLVLNPRAFSAEIREGWEIYRDEFWAREGARRRKQAHELRPKSE YAL010CMLPYMDQVLRAFYQSTHWSTQNSYEDITATSRTLLDFRIPSAIHLQISNKSTPNTFNSLDFSTRSRINGSLSYLYSDAQQLEKFMRNSTDIPLQDATETYRQLQPNLNFSVSSANTLSSDNTTVDNDKKLLHDSKFVKKSLYYGRMYYPSSDLEAMIIKRLSPQTQFMLKGVSSFKESLNVLTCYFQRDSHRNLQEWIFSTSDLLCGYRVLHNFLTTPSKFNTSLYNNSSLSLGAEFWLGLVSLSPGC
Re: [Boston.pm] Which T-station for tomorrow's meeting?
On Mon, 2004-04-26 at 13:20, Kenneth A Graves wrote: On Mon, 2004-04-26 at 12:52, Kripa Sundar wrote: I am planning to park at Riverside (the D Green line), and take the inbound train. Which T station should I get out at? Do I need to switch to a different Green line? It's a short walk from Kenmore. (Or a short walk from Blandford on the B line. Not sure which is closer, but I doubt it's worth the trouble to switch trains.) 565 Comm is closer to Kenmore Sq. (almost in the sq.) than it is to Blanford. However since the T exits are toward the other end of the square, the building is probably about halfway between the exit the Blandford St. stop. Uh, so yeah, don't bother to switch trains. :) -- Sean Quinlan [EMAIL PROTECTED] signature.asc Description: This is a digitally signed message part ___ Boston-pm mailing list [EMAIL PROTECTED] http://mail.pm.org/mailman/listinfo/boston-pm
Re: [Boston.pm] meetings at BU
On Tue, 2004-04-13 at 21:11, Uri Guttman wrote: RJK A regular day would be fine. I think many people would prefer RJK it, in fact. OK, if this moves forward I'll get us on the regular schedule. Second Tuesdays? and what about the beer/soda/pizza? can't we dip into john silber's petty cash account for that? Doubtful. Given that I'm going through the same person who was working with me for hosting YAPC and was a bit miffed at doing a lot of leg work then not being able to get required information to move forward, I'd rather not push my luck just now. However, Perl is the main language taught under the Bioinformatics Program (whose space we'd be using), so if we start getting a regular showing of students, we _may_ be able to work something out next fall. -- Sean Quinlan [EMAIL PROTECTED] signature.asc Description: This is a digitally signed message part ___ Boston-pm mailing list [EMAIL PROTECTED] http://mail.pm.org/mailman/listinfo/boston-pm
Re: [Boston.pm] Tech meeting?
If Boston.com is not available I do have access to rooms near the T. However they are normal conference room size - fitting more than 15 or maybe 20 would be difficult. However, given the usual meeting time, there is a good chance I'd be able to secure a class/lecture room here at Boston University which could handle 25-30 people at least and probably 50 at standing capacity. There would, of course, be no pizza or beverages (other than maybe water) provided though. Ronald, please let me know if I should pursue this, either for our next meeting or for potential longer term use. On Thu, 2004-04-08 at 16:26, Chris Devers wrote: On Thu, 8 Apr 2004, Ronald J Kimball wrote: On Thu, Apr 08, 2004 at 02:51:13PM -0400, Mike Burns wrote: Is a tech meeting happening soon? Boston.com hasn't committed yet to hosting a tech meeting this month. If that doesn't work out, I have at least one other possible location, but it's not on the T. :/ If, hypothetically speaking, Boston.com couldn't host meetings any more, can anyone think of a suitable backup location? It might be worth having a backup venue to work with. What criteria would we want for a backup? I can think of a few points: * a room that can regularly accomdate 25 people or so, and can occasionally handle 50 or 75. * a projection screen, or at least a white wall * accessible by T and, ideally, with parking available as well * a reasonably central location would be nice, but then [a] having T access kind of implies central, but then [b] parking availability kind of implies suburbs; prioritize as you will. My hunch is that perks like pizza beer would be nice to have but difficult to find. Wi-fi might be another good perk. For some talks, having network access for at least the speaker might be handy. I think a classroom would be ideal, if anyone had connections to a local school that would be willing to grant us occasional access to one... -- Sean Quinlan [EMAIL PROTECTED] Those who profess to favor freedom, and yet deprecate agitation, are men who want rain without thunder and lightning. They want the ocean without the roar of its many waters. -- Frederick Douglass signature.asc Description: This is a digitally signed message part ___ Boston-pm mailing list [EMAIL PROTECTED] http://mail.pm.org/mailman/listinfo/boston-pm
Re: [Boston.pm] emergency social meeting
GA! I missed beer?!?! Oh the pain! On Sat, 2004-04-03 at 01:56, Uri Guttman wrote: an IRC friend, ua, from the left coast is in town and i said i would convene an emergency social meeting for him. it will be this sunday, april 4th at 7pm at john harvard's in harvard sq. email back to the list so we can get a head count and know who to expect. uri -- Sean Quinlan [EMAIL PROTECTED] signature.asc Description: This is a digitally signed message part ___ Boston-pm mailing list [EMAIL PROTECTED] http://mail.pm.org/mailman/listinfo/boston-pm
Re: [Boston.pm] meeting?
On Thu, 2004-04-01 at 19:36, Uri Guttman wrote: what about a set of lightning talks? we have many people who are just too shy but 5 minutes on some perl topic can be done by anyone! I could do a lightning talk on one of two current projects (or both). I've got a central authorization server I'm working on and a program I just 'finished' to predict WD repeats (an interesting protein structure). -- Sean Quinlan [EMAIL PROTECTED] signature.asc Description: This is a digitally signed message part ___ Boston-pm mailing list [EMAIL PROTECTED] http://mail.pm.org/mailman/listinfo/boston-pm
Re: [Boston.pm] Just in time for christmas
On Wed, 2004-03-10 at 12:11, Kenneth A Graves wrote: On Wed, 2004-03-10 at 11:39, [EMAIL PROTECTED] wrote: that means perl 6.0 should be a stable release by mid November. Hey, just in time for XMAS!!! Le Sigh With the lack of a tech meeting this month, should we have a social meeting? Want to try John Harvard again, since the holidays cut attendance last time? Sounds good to me! No surprise there though =P -- Sean Quinlan [EMAIL PROTECTED] signature.asc Description: This is a digitally signed message part ___ Boston-pm mailing list [EMAIL PROTECTED] http://mail.pm.org/mailman/listinfo/boston-pm
Re: [Boston.pm] OT - Redhat Enterprise - X screen resolution
Is there really _NO_ Xconfig manager in Red Hat anymore?!?! On Mon, 2004-03-01 at 18:14, Ranga Nathan wrote: When I installed Redhat Enterprise Server, I asked for a high resolution (1600x1200, I think) but now I want to lower it. Under Gnome 2 / KDE I dont find a way to change the geometry. Redhat suggests running 'redhat-config-xfree86' but I dont find it anywhere. I looked at XF86Config and it is confusing. Any suggestions? Thanks ___ Boston-pm mailing list [EMAIL PROTECTED] http://mail.pm.org/mailman/listinfo/boston-pm -- Sean Quinlan [EMAIL PROTECTED] signature.asc Description: This is a digitally signed message part ___ Boston-pm mailing list [EMAIL PROTECTED] http://mail.pm.org/mailman/listinfo/boston-pm
[Boston.pm] Compression without temp file
I'm trying to find a way to compress large text strings (genomes) for storing in a database. I'd really prefer to avoid using temp files if possible. Not so much for loading the data, but I'm hoping to use the same methodology on the occasion I need to decompress and use that data. I searched CPAN but didn't find anything that appeared to provide that functionality. I've also struggled with opening a pipe to gzip; it compresses fine but I haven't figured out a way to capture gzips output, which it forces to my terminal. Anyone have a solution they would like to suggest? TIA! -- Sean Quinlan [EMAIL PROTECTED] signature.asc Description: This is a digitally signed message part ___ Boston-pm mailing list [EMAIL PROTECTED] http://mail.pm.org/mailman/listinfo/boston-pm
Re: [Boston.pm] Compression without temp file
On Thu, 2004-02-12 at 19:37, Chris Devers wrote: I assume you tried CPAN? Of course (and um, I mention that in the email). http://search.cpan.org/search?query=gzipmode=all First hit is PerlIO::gzip, which looks promising... Yes, I skimmed over that one. However I'm trying to find a way to do it without using files, which PerlIO::gzip seems to be doing. Thanks! -- Sean Quinlan [EMAIL PROTECTED] signature.asc Description: This is a digitally signed message part ___ Boston-pm mailing list [EMAIL PROTECTED] http://mail.pm.org/mailman/listinfo/boston-pm
Re: [Boston.pm] Compression without temp file
On Thu, 2004-02-12 at 20:18, Gyepi SAM wrote: Yes, it does use files, but newish perls support the concept of in-memory files. So the PerlIO::gzip example becomes: use PerlIO::gzip; my $string; open FOO, :gzip, \$string or die $!; print FOO 'blah blah blah'; close FOO; print $string; #careful, this may mess up your terminal! Thanks Gyepi! Unfortunately, while this did not throw any errors, it also did not produce any output? 100: 8:50pm % perl -v This is perl, v5.8.1 built for i586-linux-thread-multi -- Sean Quinlan [EMAIL PROTECTED] signature.asc Description: This is a digitally signed message part ___ Boston-pm mailing list [EMAIL PROTECTED] http://mail.pm.org/mailman/listinfo/boston-pm
Re: [Boston.pm] Compression without temp file
On Thu, 2004-02-12 at 19:26, Jeremy Muhlich wrote: Check out Compress::Zlib . This works fine, and I've got a first working version completed. Thanks everyone! -- Sean Quinlan [EMAIL PROTECTED] signature.asc Description: This is a digitally signed message part ___ Boston-pm mailing list [EMAIL PROTECTED] http://mail.pm.org/mailman/listinfo/boston-pm
Re: [Boston.pm] Compression without temp file
On Thu, 2004-02-12 at 21:21, Gyepi SAM wrote: I just installed PerlIO::gzip so I could test the example and it works for me, so it must be you or your system ;) Was your perl built with perlio? perl -V|grep io should produce at this something like this: useperlio=define d_sfio=undef I indeed got: 104: 8:52pm % perl -V|grep io Summary of my perl5 (revision 5.0 version 8 subversion 1) configuration: ... useperlio=define d_sfio=undef uselargefiles=define usesocks=undef I didn't make a script, I just pasted your post into a command line. After the first try with no results I also tried it slurping a short file. Besides simply printing it I tried both redirecting to a file and opening an output file. The files created both ways were 0 length. I have no idea why - but I'll try it again on a different machine later. Thanks again! btw, if you save the example to a file and pipe the script output to 'gunzip -c', you get back the original string, which serves as a nice test of the whole process. -Gyepi ___ Boston-pm mailing list [EMAIL PROTECTED] http://mail.pm.org/mailman/listinfo/boston-pm -- Sean Quinlan [EMAIL PROTECTED] signature.asc Description: This is a digitally signed message part ___ Boston-pm mailing list [EMAIL PROTECTED] http://mail.pm.org/mailman/listinfo/boston-pm
Re: [Boston.pm] new to the group
On Thu, 2003-12-18 at 09:03, Richard Morse wrote: it is in sean's court to organize it. let's all give him a gentle punch ina face or a blow to the head to encourage him do this. Are you sure you want this Uri? It sounds to me like a good way to not have a meeting scheduled... Nah Uri knows me well enough - thick headed and not to pretty to begin with. Of course, I also hit back =P Gathering details to follow. -- Sean Quinlan [EMAIL PROTECTED] signature.asc Description: This is a digitally signed message part ___ Boston-pm mailing list [EMAIL PROTECTED] http://mail.pm.org/mailman/listinfo/boston-pm
Re: [Boston.pm] GUI work ...
On Tue, 2003-12-16 at 14:52, runester wrote: When you want to write something with a GUI ... what do you use? PERL/TK? PERL with WinLib? Something else entirely (like JAVA)? I'd really like to leverage my knowledge of PERL before learning an entirely new programming language, just so I can have a UI. Since most of my work is done on Windows machines, I have been writing HTA's with JavaScript and using the HTML for building my interfaces ... but there are serious limitations! I don't need UI that often, but when I do I am left in quite the quandry. Any insight would be appreciated. I have never worked with it in production, but I did play with developing a UI for Perl using Qt over the summer. It seemed to work quite well and is (supposedly) portable cross platform. There are some licensing issues that you may need to consider if using this for work as Qt is a commercial product. I'm running SuSE so I already had the whole Qt developer package handy and getting the Qt modules from CPAN installed was trivial. The best part of this, for me, was discovering that I could use the Qt developer GUI builder (classic widget assembly IDE) to build up the windows, lists etc and define the basic actions, then use an existing tool which converts the XML Qt project files into a Perl module framework for you! I had functional little test apps was adding my own code actions on the first day. :) -- Sean Quinlan [EMAIL PROTECTED] signature.asc Description: This is a digitally signed message part ___ Boston-pm mailing list [EMAIL PROTECTED] http://mail.pm.org/mailman/listinfo/boston-pm
Re: [Boston.pm] Off topic: What if carpenters were hired like programmers
LMAO!!! Thanks Jim! On Thu, 2003-12-18 at 15:48, James Freeman wrote: From: James Freeman [EMAIL PROTECTED] Date: Thu Dec 18, 2003 2:56:53 PM US/Eastern To: [EMAIL PROTECTED] Cc: James Freeman [EMAIL PROTECTED] Subject: Off topic: What if carpenters were hired like programmers Hi Folks, Saw this online, and I thought the group would find this interesting. http://www.particlewave.com/stories/2003/07/01/ ifCarpentersWereHiredLikeProgrammers Warmest Regards, Jim ___ Boston-pm mailing list [EMAIL PROTECTED] http://mail.pm.org/mailman/listinfo/boston-pm -- Sean Quinlan [EMAIL PROTECTED] signature.asc Description: This is a digitally signed message part ___ Boston-pm mailing list [EMAIL PROTECTED] http://mail.pm.org/mailman/listinfo/boston-pm
Re: [Boston.pm] SuSE Linux - can not find YaST
On Thu, 2003-12-18 at 14:32, Ranga Nathan wrote: We are installing Linux on z/800 (mainframe). We are unable to find yast in the distro. Any ideas? First, I don't think YAST2 is used as the installer. I can't recall the name of the program that is unfortunately. Although I do think it uses a number of yast modules for managing configuring certain parts if requested. What version of SuSE are you installing? If you boot from CD and choose Installation it should walk you through the process. I've installed SuSE 30+ times on at least 15 different machines (although all PC variants) since version 7 and have never had a problem getting install started from CD or DVD. If your system can't boot from disk, look into the docs directory. There should be a number of howto's outlining the process for a number of different install methods. There should also be a boot directory with floppy boot disk images if your system can boot from floppy. HTH -- Sean Quinlan [EMAIL PROTECTED] signature.asc Description: This is a digitally signed message part ___ Boston-pm mailing list [EMAIL PROTECTED] http://mail.pm.org/mailman/listinfo/boston-pm
Re: [Boston.pm] new to the group
On Mon, 2003-12-15 at 23:10, Uri Guttman wrote: t == toisanji308 [EMAIL PROTECTED] writes: Hi all, Just saying hi. Just wondering, do you guys ever meet up, I'd like to meet other perl people in the area. I've used perl on and off for years, but I just started to really get into it and it is much more fun to use then other other languages I use. Welcome indeed! :) welcome aboard. we meet monthly at boston.com's place in south boston. Which is nicer and certainly roomier than Uri's attic BTW. ;-} we just had a meeting last week so you missed that one. just hang out on the list and you will hear about meetings and their scheduled talks and such. you can also ask/answer perl questions on this list as well. and sometimes we have social meetings at a local pub or someone's house but those are irregular. Too irregular! And I'm feeling guilty about not making many tech meetings lately. Anyone interested in a pub meet over the holidays? -- Sean Quinlan [EMAIL PROTECTED] signature.asc Description: This is a digitally signed message part ___ Boston-pm mailing list [EMAIL PROTECTED] http://mail.pm.org/mailman/listinfo/boston-pm
RE: [Boston.pm] [Fwd: perl needs your support]
On Tue, 2003-12-09 at 08:29, Tolkin, Steve wrote: Dear Sean, Perhaps I will want to respond to this. But due to extreme number of viruses in attachments, and even mail from known people being sent by viruses, I wish you would paste the contents directly into the message and not have an attachment. Sorry if that caused worry for you. It should have been a plain text attachment, and viewable as text in the email (I suppose that depends on your email client). I also digitally sign my email, which I don't think a virus is capable of??? But I will try to remember to include rather than attach when email lists. Thanks -- Sean Quinlan [EMAIL PROTECTED] signature.asc Description: This is a digitally signed message part ___ Boston-pm mailing list [EMAIL PROTECTED] http://mail.pm.org/mailman/listinfo/boston-pm
[Boston.pm] [Fwd: perl needs your support]
-- Sean Quinlan [EMAIL PROTECTED] ---BeginMessage--- help perl beat out those heretics python and C# in the language bindings poll at http://gnomedesktop.org/ ! -- that's it! you're a genius! yes. that's what i think. do you think i deserve a raise? - dialogue from 'Godzilla versus Mothra', 1964 ---End Message--- signature.asc Description: This is a digitally signed message part ___ Boston-pm mailing list [EMAIL PROTECTED] http://mail.pm.org/mailman/listinfo/boston-pm
[Boston.pm] inheritance problem
OK, I have this method, gripe, in my base class (Foo) which does some verbosity sensitive error message control. I have another class (Foo::Bar) that base's the first. package Foo::Bar; use base(Foo); Now in my code things like: $baz = Foo::Bar-new(); $baz-gripe(What happened?); Work just fine, like expected. Where I'm having trouble is in that new up there. What I wanted to do is be able to call gripe from inside new, before $self has been blessed (while I'm validating parameters): # self as first arg so gripe doesn't need recoding gripe($self,Now what?); But that doesn't work. Now I thought use'ing base meant it inherited all of the base class' methods. But apparently it can't find them until after the object hass been blessed and gripe is called in OOP syntax $self-gripe(yeah yeah yeah);. So now, in my nice new OOP set of modules, I find myself having to use exporter and export this function, and in my subclasses I need to do: use base(Foo); use Foo; I find this incredibly annoying! Ugly! Inelegant! Am I missing something? Am I really going to have to import those methods the old-fashioned way? If anyone has suggestion to have this work the way I expected, or an elegant way to accomplish this, I'd appriciate it. So far my only alternate idea is to bless $self right away but not return it unless validation passes. If not, could those on the list working on newer versions of Perl kindly fix this please. Or explain why this has to be (preferably in samll words)? Thanks! -- Sean Quinlan [EMAIL PROTECTED] signature.asc Description: This is a digitally signed message part ___ Boston-pm mailing list [EMAIL PROTECTED] http://mail.pm.org/mailman/listinfo/boston-pm
Re: [Boston.pm] inheritance problem
ROFL! Sorry Uri, no fortune here. On Fri, 2003-08-15 at 15:22, Uri Guttman wrote: just from the subject i was going to guess that you had a large fortune and lived in some far away country but couldn't pass on your fortune since you had no heirs and wanted my help to extract your inheritance from the bank in some other place where you had stashed it. but to my dismay, it was just a query about OO perl. :( uri -- Sean Quinlan [EMAIL PROTECTED] signature.asc Description: This is a digitally signed message part ___ Boston-pm mailing list [EMAIL PROTECTED] http://mail.pm.org/mailman/listinfo/boston-pm
Re: [Boston.pm] inheritance problem
On Fri, 2003-08-15 at 15:27, Uri Guttman wrote: SQ But that doesn't work. Now I thought use'ing base meant it inherited all SQ of the base class' methods. But apparently it can't find them until SQ after the object hass been blessed and gripe is called in OOP syntax SQ $self-gripe(yeah yeah yeah);. that is irrelevant. if you don't use a method style call, you don't get any OO semantics. so you have to have a blessed $self before you make the call and you need to make a method call. if Foo::gripe is written to take a class OR an object It is (well, I think it is - still mastering all this OOP stuff ;-} ) (and it could be done that way), then you can call it like: Foo-gripe( blah ) ; Hmmm, that wouldn't be bad at all. or even Foo::Bar-gripe( blah ) ; since you did he use base line earlier. Even better. or even: __PACKAGE__-gripe( blah ) ; :) but then you would need to use some default or package params to control how it behaves vs what is normally passes in $self. The only thing it looks for in $self is the debug value, and it already looks for a global in the callers package if it's not defined in $self. SQ If not, could those on the list working on newer versions of Perl kindly SQ fix this please. Or explain why this has to be (preferably in samll SQ words)? Thanks! it isn't a problem in perl, but in your understanding of perl OO semantics. Well, I DID ask if I was missing something! ;-} I've just gotten spoiled being so used to Perl DWIM. and now, how can i help you get your money into my account? First find a way to get some in mine!!! Thanks! uri -- Sean Quinlan [EMAIL PROTECTED] signature.asc Description: This is a digitally signed message part ___ Boston-pm mailing list [EMAIL PROTECTED] http://mail.pm.org/mailman/listinfo/boston-pm
Re: [Boston.pm] inheritance problem
On Fri, 2003-08-15 at 15:46, [EMAIL PROTECTED] wrote:
you can avoid the hard-coding.
sub new
{
my $class = shift;
# blah de blah
$class-gripe(charlie browns teacher);
my $obj = \magic beans here;
return bless $obj,$class;
}
This would allow you to get around hard coding the class name.
Done, and thanks!
If it DOES need an object, I don't quite understand why
you cant do the bless in new, call gripe, and just return
the object when you're done.
Only because it felt odd and out of order to create the object before
it's attributes and such have been validated.
sub new
{
my $class = shift;
my [EMAIL PROTECTED];
bless $obj, $class;
$obj-gripe(waaah wah whaa waaah);
$obj-magic_bean_verification;
return $obj;
}
--
Sean Quinlan [EMAIL PROTECTED]
signature.asc
Description: This is a digitally signed message part
___
Boston-pm mailing list
[EMAIL PROTECTED]
http://mail.pm.org/mailman/listinfo/boston-pm
Re: [Boston.pm-announce] Re: [Boston.pm] Tech Meeting Tue, Dec 10
On Wed, 2002-12-04 at 19:31, Elaine -HFB- Ashton wrote: How about an agenda of Beer and Holiday cheer? :) Maybe the usual CBC or the Coyote Grill next door which makes some pretty mean margs? :) As always - here here! :) How about the 18th or 19th of Dec.? -- Sean Quinlan [EMAIL PROTECTED] ___ Boston-pm mailing list [EMAIL PROTECTED] http://mail.pm.org/mailman/listinfo/boston-pm
[Boston.pm] YAPC 2004
Just spoke with some faculty at BU. They are _very_ interested in sponsoring YAPC for 2004. I'm getting some more #'s details from Kevin Lenzo, which we will bring to BU administration to try to secure reservations. I won't know for certain probably until next week at the earliest, but the current hope is that the Bioinformatics program (part of the Biomedical Engineering dept.) will sponsor the conference, and provide us rooms/space/services at thier cost (what they pay to the university). We will try to convice BU to reduce the cost even further and write off the expense as a charitable donation (or perhaps provide catering and other services), but no one is holding their breath on that. Wish me luck! -- Sean Quinlan [EMAIL PROTECTED] ___ Boston-pm mailing list [EMAIL PROTECTED] http://mail.pm.org/mailman/listinfo/boston-pm
Re: [Boston.pm] file uploads w/Perl CGI
On Fri, 2002-10-04 at 11:23, John Tobey wrote:
On Fri, Oct 04, 2002 at 01:40:49PM -0400, Sean Quinlan wrote:
Then in the subroutine where you read the file:
my $datafile = $CGI-param('datafile');
while ($datafile) {
# some stuff
} # while
That's pretty much all there is to it on the server side. I've always
found the docs a little confusing on how to get the usuable filehandle,
but the above always works for me.
Then you must not be using strict or perhaps it has been fixed in
newer perls? I am using $fh = upload('file'). (I am happy using
the function interface to CGI.pm.)
Of course I'm using strict. Warnings too. Why do you suggest I'm not, or
what was broken?
(This thread no longer relates directly to posters original question)
___
Boston-pm mailing list
[EMAIL PROTECTED]
http://mail.pm.org/mailman/listinfo/boston-pm
