On 6/12/2014 8:13 AM, lina wrote: > Hi, > > I wish to grab part of the CDS entry from > > http://www.ncbi.nlm.nih.gov/nuccore/KF699528.2 > > namely, > > "MLDHSSVNSTIAPGNLLNLPVWCYLLETEEGPILVDTGMPESAV > > NNEGLFNGTFVEGQILPKMTEEDRIVNILKRVGYEPDDLLYIISSHLHFDHAGGNGAF > > TNTPIIVQRTEYEAALHREEYMKECILPHLNYKIIEGDYEVVPGVQLLYTPGHSPGHQ > > SLFIETEQSGSILLTIDASYTKENFEDEVPFAGFDPELALSSIKRLKEVVAKEKPIIF > FGHDIEQEKGCKVFPEYIPRAE" > > > I tried to view the source code, but it doesn't show this part, and when > I used > > wget http://www.ncbi.nlm.nih.gov/nuccore/KF699528.2 > > the thing I grabbed also doesn't show this part. > > Because I have lots of things with different end part > http://www.ncbi.nlm.nih.gov/nuccore/**** > > so it is going to be nice to know how to get these html plain file which > contains these sequence, > > can anyone points out something to let me go further, > > Thanks, lina >
Lina, Looking at the page source, the data are loaded via javascript (specifically, JQuery). You would either need a javascript interpreter to handle the source page, or parse the page yourself to find out what the source of the data you wish is. Jerry -- To UNSUBSCRIBE, email to [email protected] with a subject of "unsubscribe". Trouble? Contact [email protected] Archive: https://lists.debian.org/[email protected]
