Author: markt
Date: Thu Mar 30 09:20:56 2017
New Revision: 1789476
URL: http://svn.apache.org/viewvc?rev=1789476&view=rev
Log:
Add [...] delimiters to values in messages that don't currently have them for
org.apache.jasper packages
Modified:
tomcat/trunk/java/org/apache/jasper/resources/LocalStrings.properties
tomcat/trunk/java/org/apache/jasper/resources/LocalStrings_es.properties
tomcat/trunk/java/org/apache/jasper/resources/LocalStrings_fr.properties
tomcat/trunk/java/org/apache/jasper/resources/LocalStrings_ja.properties
Modified: tomcat/trunk/java/org/apache/jasper/resources/LocalStrings.properties
URL:
http://svn.apache.org/viewvc/tomcat/trunk/java/org/apache/jasper/resources/LocalStrings.properties?rev=1789476&r1=1789475&r2=1789476&view=diff
==============================================================================
--- tomcat/trunk/java/org/apache/jasper/resources/LocalStrings.properties
(original)
+++ tomcat/trunk/java/org/apache/jasper/resources/LocalStrings.properties Thu
Mar 30 09:20:56 2017
@@ -20,65 +20,65 @@ jsp.error.compiler=No Java compiler avai
jsp.error.no.scratch.dir=The JSP engine is not configured with a scratch dir.\
\n Please add "jsp.initparams=scratchdir=<dir-name>" \
\n in the servlets.properties file for this context.
-jsp.error.bad.scratch.dir=The scratchDir you specified: {0} is unusable.
-jsp.message.scratch.dir.is=Scratch dir for the JSP engine is: {0}
-jsp.message.parent_class_loader_is=Parent class loader is: {0}
+jsp.error.bad.scratch.dir=The scratchDir you specified: [{0}] is unusable.
+jsp.message.scratch.dir.is=Scratch dir for the JSP engine is: [{0}]
+jsp.message.parent_class_loader_is=Parent class loader is: [{0}]
jsp.message.dont.modify.servlets=IMPORTANT: Do not modify the generated
servlets
jsp.error.unavailable=JSP has been marked unavailable
-jsp.error.usebean.duplicate=useBean: Duplicate bean name: {0}
-jsp.error.invalid.scope=Illegal value of ''scope'' attribute: {0} (must be one
of "page", "request", "session", or "application")
+jsp.error.usebean.duplicate=useBean: Duplicate bean name: [{0}]
+jsp.error.invalid.scope=Illegal value of ''scope'' attribute: [{0}] (must be
one of "page", "request", "session", or "application")
jsp.error.classname=Can't determine classname from .class file
jsp.error.outputfolder=No output folder
jsp.error.data.file.write=Error while writing data file
-jsp.error.page.conflict.contenttype=Page directive: illegal to have multiple
occurrences of ''contentType'' with different values (old: {0}, new: {1})
-jsp.error.page.conflict.session=Page directive: illegal to have multiple
occurrences of ''session'' with different values (old: {0}, new: {1})
+jsp.error.page.conflict.contenttype=Page directive: illegal to have multiple
occurrences of ''contentType'' with different values (old: [{0}], new: [{1}])
+jsp.error.page.conflict.session=Page directive: illegal to have multiple
occurrences of ''session'' with different values (old: [{0}], new: [{1}])
jsp.error.page.invalid.session=Page directive: invalid value for session
-jsp.error.page.conflict.buffer=Page directive: illegal to have multiple
occurrences of ''buffer'' with different values (old: {0}, new: {1})
+jsp.error.page.conflict.buffer=Page directive: illegal to have multiple
occurrences of ''buffer'' with different values (old: [{0}], new: [{1}])
jsp.error.page.invalid.buffer=Page directive: invalid value for buffer
-jsp.error.page.conflict.autoflush=Page directive: illegal to have multiple
occurrences of ''autoFlush'' with different values (old: {0}, new: {1})
+jsp.error.page.conflict.autoflush=Page directive: illegal to have multiple
occurrences of ''autoFlush'' with different values (old: [{0}], new: [{1}])
jsp.error.page.invalid.import=Page directive: invalid value for import
-jsp.error.page.conflict.isthreadsafe=Page directive: illegal to have multiple
occurrences of ''isThreadSafe'' with different values (old: {0}, new: {1})
+jsp.error.page.conflict.isthreadsafe=Page directive: illegal to have multiple
occurrences of ''isThreadSafe'' with different values (old: [{0}], new: [{1}])
jsp.error.page.invalid.isthreadsafe=Page directive: invalid value for
isThreadSafe
-jsp.error.page.conflict.info=Page directive: illegal to have multiple
occurrences of ''info'' with different values (old: {0}, new: {1})
+jsp.error.page.conflict.info=Page directive: illegal to have multiple
occurrences of ''info'' with different values (old: [{0}], new: [{1}])
jsp.error.page.invalid.info=Page directive: invalid value for info
-jsp.error.page.conflict.iserrorpage=Page directive: illegal to have multiple
occurrences of ''isErrorPage'' with different values (old: {0}, new: {1})
+jsp.error.page.conflict.iserrorpage=Page directive: illegal to have multiple
occurrences of ''isErrorPage'' with different values (old: [{0}], new: [{1}])
jsp.error.page.invalid.iserrorpage=Page directive: invalid value for
isErrorPage
-jsp.error.page.conflict.errorpage=Page directive: illegal to have multiple
occurrences of ''errorPage'' with different values (old: {0}, new: {1})
-jsp.error.page.conflict.language=Page directive: illegal to have multiple
occurrences of ''language'' with different values (old: {0}, new: {1})
-jsp.error.tag.conflict.language=Tag directive: illegal to have multiple
occurrences of ''language'' with different values (old: {0}, new: {1})
+jsp.error.page.conflict.errorpage=Page directive: illegal to have multiple
occurrences of ''errorPage'' with different values (old: [{0}], new: [{1}])
+jsp.error.page.conflict.language=Page directive: illegal to have multiple
occurrences of ''language'' with different values (old: [{0}], new: [{1}])
+jsp.error.tag.conflict.language=Tag directive: illegal to have multiple
occurrences of ''language'' with different values (old: [{0}], new: [{1}])
jsp.error.page.language.nonjava=Page directive: invalid language attribute
jsp.error.tag.language.nonjava=Tag directive: invalid language attribute
-jsp.error.page.conflict.extends=Page directive: illegal to have multiple
occurrences of ''extends'' with different values (old: {0}, new: {1})
-jsp.error.page.conflict.iselignored=Page directive: illegal to have multiple
occurrences of ''isELIgnored'' with different values (old: {0}, new: {1})
-jsp.error.tag.conflict.iselignored=Tag directive: illegal to have multiple
occurrences of ''isELIgnored'' with different values (old: {0}, new: {1})
+jsp.error.page.conflict.extends=Page directive: illegal to have multiple
occurrences of ''extends'' with different values (old: [{0}], new: [{1}])
+jsp.error.page.conflict.iselignored=Page directive: illegal to have multiple
occurrences of ''isELIgnored'' with different values (old: [{0}], new: [{1}])
+jsp.error.tag.conflict.iselignored=Tag directive: illegal to have multiple
occurrences of ''isELIgnored'' with different values (old: [{0}], new: [{1}])
jsp.error.page.invalid.iselignored=Page directive: invalid value for
isELIgnored
jsp.error.tag.invalid.iselignored=Tag directive: invalid value for isELIgnored
jsp.error.page.multi.pageencoding=Page directive must not have multiple
occurrences of pageencoding
-jsp.error.tag.conflict.attr=Tag directive: illegal to have multiple
occurrences of the attribute [{0}] with different values (old: {1}, new: {2})
+jsp.error.tag.conflict.attr=Tag directive: illegal to have multiple
occurrences of the attribute [{0}] with different values (old: [{1}], new:
[{2}])
jsp.error.tag.multi.pageencoding=Tag directive must not have multiple
occurrences of pageencoding
-jsp.error.include.exception=Unable to include {0}
+jsp.error.include.exception=Unable to include [{0}]
jsp.error.stream.close.failed=Failed to close stream
jsp.error.stream.closed=Stream closed
jsp.error.invalid.directive=Invalid directive
-jsp.error.invalid.implicit=Invalid implicit TLD for tag file at {0}
-jsp.error.invalid.implicit.version=Invalid JSP version defined in implicit TLD
for tag file at {0}
-jsp.error.invalid.version=Invalid JSP version defined for tag file at {0}
-jsp.error.directive.istagfile={0} directive cannot be used in a tag file
-jsp.error.directive.isnottagfile={0} directive can only be used in a tag file
-jsp.error.action.istagfile={0} action cannot be used in a tag file
-jsp.error.action.isnottagfile={0} action can be used in tag files only
-jsp.error.unterminated=Unterminated {0} tag
+jsp.error.invalid.implicit=Invalid implicit TLD for tag file at [{0}]
+jsp.error.invalid.implicit.version=Invalid JSP version defined in implicit TLD
for tag file at [{0}]
+jsp.error.invalid.version=Invalid JSP version defined for tag file at [{0}]
+jsp.error.directive.istagfile=[{0}] directive cannot be used in a tag file
+jsp.error.directive.isnottagfile=[{0}] directive can only be used in a tag file
+jsp.error.action.istagfile=[{0}] action cannot be used in a tag file
+jsp.error.action.isnottagfile=[{0}] action can be used in tag files only
+jsp.error.unterminated=Unterminated [{0}] tag
jsp.error.loadclass.taghandler=Unable to load tag handler class [{0}] for tag
[{1}]
jsp.error.unable.compile=Unable to compile class for JSP
jsp.error.unable.load=Unable to load class for JSP
-jsp.error.mandatory.attribute={0}: Mandatory attribute {1} missing
+jsp.error.mandatory.attribute=[{0}]: Mandatory attribute [{1}] missing
jsp.error.flush=Exception occurred when flushing data
jsp.engine.info=Jasper JSP 2.3 Engine
-jsp.error.invalid.expression=[{0}] contains invalid expression(s): {1}
-jsp.error.invalid.attribute={0} has invalid attribute: {1}
-jsp.error.file.cannot.read=Cannot read file: {0}
-jsp.error.file.already.registered=Recursive include of file {0}
-jsp.error.file.not.registered=file {0} not seen in include
+jsp.error.invalid.expression=[{0}] contains invalid expression(s): [{1}]
+jsp.error.invalid.attribute=[{0}] has invalid attribute: [{1}]
+jsp.error.file.cannot.read=Cannot read file: [{0}]
+jsp.error.file.already.registered=Recursive include of file [{0}]
+jsp.error.file.not.registered=file [{0}] not seen in include
jsp.error.quotes.unterminated=Unterminated quotes
jsp.error.attr.quoted=Attribute value should be quoted
jsp.error.beans.nullbean=Attempted a bean operation on a null object.
@@ -86,7 +86,7 @@ jsp.error.beans.nobeaninfo=No BeanInfo f
jsp.error.beans.nomethod=Cannot find a method to read property [{0}] in a bean
of type [{1}]
jsp.error.beans.nomethod.setproperty=Can''t find a method to write property
[{0}] of type [{1}] in a bean of type [{2}]
jsp.error.beans.noproperty=Cannot find any information on property [{0}] in a
bean of type [{1}]
-jsp.error.beans.property.conversion=Unable to convert string [{0}] to class
[{1}] for attribute [{2}]: {3}
+jsp.error.beans.property.conversion=Unable to convert string [{0}] to class
[{1}] for attribute [{2}]: [{3}]
jsp.error.beans.propertyeditor.notregistered=Property Editor not registered
with the PropertyEditorManager
jsp.error.beans.setproperty.noindexset=Cannot set indexed property
jsp.error.include.tag=Invalid jsp:include tag
@@ -105,7 +105,7 @@ jsp.error.plugin.nocode=code not declare
jsp.error.ise_on_clear=Illegal to clear() when buffer size == 0
jsp.error.javac=Javac exception
jsp.error.javac.env=Environment:
-jsp.error.compilation=Error compiling file: {0} {1}
+jsp.error.compilation=Error compiling file: [{0}] [{1}]
jsp.error.undeclared_namespace=A custom tag was encountered with an undeclared
namespace [{0}]
jsp.warning.keepgen=Warning: Invalid value for the initParam keepgenerated.
Will use the default value of "false"
jsp.warning.xpoweredBy=Warning: Invalid value for the initParam xpoweredBy.
Will use the default value of "false"
@@ -133,17 +133,17 @@ jsp.warning.unknown.element.in.variable=
jsp.warning.unknown.element.in.validator=Unknown element [{0}] in validator
jsp.warning.unknown.element.in.initParam=Unknown element [{0}] in validator''s
init-param
jsp.warning.unknown.element.in.function=Unknown element [{0}] in function
-jsp.error.teiclass.instantiation=Failed to load or instantiate TagExtraInfo
class: {0}
-jsp.error.non_null_tei_and_var_subelems=Tag {0} has one or more variable
subelements and a TagExtraInfo class that returns one or more VariableInfo
-jsp.error.parse.error.in.TLD=Parse Error in the tag library descriptor: {0}
+jsp.error.teiclass.instantiation=Failed to load or instantiate TagExtraInfo
class: [{0}]
+jsp.error.non_null_tei_and_var_subelems=Tag [{0}] has one or more variable
subelements and a TagExtraInfo class that returns one or more VariableInfo
+jsp.error.parse.error.in.TLD=Parse Error in the tag library descriptor: [{0}]
jsp.error.file.not.found=File [{0}] not found
-jsp.error.missing_attribute=According to the TLD or the tag file, attribute
{0} is mandatory for tag {1}
-jsp.error.bad_attribute=Attribute {0} invalid for tag {1} according to TLD
-jsp.error.tld.unable_to_get_jar=Unable to get JAR resource [{0}] containing
TLD: {1}
-jsp.error.tld.missing=Unable to find taglib [{0}] for URI: {1}
+jsp.error.missing_attribute=According to the TLD or the tag file, attribute
[{0}] is mandatory for tag [{1}]
+jsp.error.bad_attribute=Attribute [{0}] invalid for tag [{1}] according to TLD
+jsp.error.tld.unable_to_get_jar=Unable to get JAR resource [{0}] containing
TLD: [{1}]
+jsp.error.tld.missing=Unable to find taglib [{0}] for URI: [{1}]
jsp.error.tld.missing_jar=Missing JAR resource [{0}] containing TLD
jsp.error.tld.invalid_tld_file=Invalid tld file: [{0}], see JSP specification
section 7.3.1 for more details
-jsp.error.unable.to_find_method=Unable to find setter method for attribute: {0}
+jsp.error.unable.to_find_method=Unable to find setter method for attribute:
[{0}]
jsp.error.bad_tag=No tag [{0}] defined in tag library imported with prefix
[{1}]
jsp.error.xml.bad_tag=No tag [{0}] defined in tag library associated with uri
[{1}]
jsp.warning.compiler.classfile.delete.fail=Failed to delete generated class
file [{0}]
@@ -219,75 +219,75 @@ jspc.error.fileDoesNotExist=The file arg
jspc.delete.fail=Failed to delete file [{0}]
jspc.error.invalidWebXml=Aborting pre-compilation due to errors in web.xml
jspc.error.invalidFragment=Aborting pre-compilation due to errors in web
fragments
-jsp.error.library.invalid=JSP page is invalid according to library {0}: {1}
-jsp.error.tlvclass.instantiation=Failed to load or instantiate
TagLibraryValidator class: {0}
-jsp.error.tlv.invalid.page=Validation error messages from TagLibraryValidator
for {0} in {1}
-jsp.error.tei.invalid.attributes=Validation error messages from TagExtraInfo
for {0}
+jsp.error.library.invalid=JSP page is invalid according to library [{0}]: [{1}]
+jsp.error.tlvclass.instantiation=Failed to load or instantiate
TagLibraryValidator class: [{0}]
+jsp.error.tlv.invalid.page=Validation error messages from TagLibraryValidator
for [{0}] in [{1}]
+jsp.error.tei.invalid.attributes=Validation error messages from TagExtraInfo
for [{0}]
jsp.error.no.more.content=End of content reached while more parsing required:
tag nesting error?
-jsp.error.parse.xml=XML parsing error on file {0}
-jsp.error.parse.xml.line=XML parsing error on file {0}: (line {1}, col {2})
-jsp.error.parse.xml.scripting.invalid.body=Body of {0} element must not
contain any XML elements
-jsp.error.internal.tldinit=Unable to initialize TldLocationsCache: {0}
-jsp.error.internal.filenotfound=Internal Error: File {0} not found
-jsp.error.parse.xml.invalidPublicId=Invalid PUBLIC ID: {0}
-jsp.error.unsupported.encoding=Unsupported encoding: {0}
-jsp.error.taglibDirective.absUriCannotBeResolved=The absolute uri: {0} cannot
be resolved in either web.xml or the jar files deployed with this application
+jsp.error.parse.xml=XML parsing error on file [{0}]
+jsp.error.parse.xml.line=XML parsing error on file [{0}]: (line [{1}], col
[{2}])
+jsp.error.parse.xml.scripting.invalid.body=Body of [{0}] element must not
contain any XML elements
+jsp.error.internal.tldinit=Unable to initialize TldLocationsCache: [{0}]
+jsp.error.internal.filenotfound=Internal Error: File [{0}] not found
+jsp.error.parse.xml.invalidPublicId=Invalid PUBLIC ID: [{0}]
+jsp.error.unsupported.encoding=Unsupported encoding: [{0}]
+jsp.error.taglibDirective.absUriCannotBeResolved=The absolute uri: [{0}]
cannot be resolved in either web.xml or the jar files deployed with this
application
jsp.error.taglibDirective.uriInvalid=The URI provided for a tag library [{0}]
is not a valid URI
jsp.error.taglibDirective.missing.location=Neither 'uri' nor 'tagdir'
attribute specified
jsp.error.taglibDirective.both_uri_and_tagdir=Both 'uri' and 'tagdir'
attributes specified
-jsp.error.invalid.tagdir=Tag file directory {0} does not start with
"/WEB-INF/tags"
-#jspx.error.templateDataNotInJspCdata=Validation Error: Element <{0}>
cannot have template data. Template data must be encapsulated within a
<jsp:cdata> element. [JSP1.2 PFD section 5.1.9]\nTemplate data in error:
{1}
-#Error while processing taglib jar file {0}: {1}
-jsp.error.needAlternateJavaEncoding=Default java encoding {0} is invalid on
your java platform. An alternate can be specified via the ''javaEncoding''
parameter of JspServlet.
+jsp.error.invalid.tagdir=Tag file directory [{0}] does not start with
"/WEB-INF/tags"
+#jspx.error.templateDataNotInJspCdata=Validation Error: Element <{0}>
cannot have template data. Template data must be encapsulated within a
<jsp:cdata> element. [JSP1.2 PFD section 5.1.9]\nTemplate data in error:
[{1}]
+#Error while processing taglib jar file [{0}]: [{1}]
+jsp.error.needAlternateJavaEncoding=Default java encoding [{0}] is invalid on
your java platform. An alternate can be specified via the ''javaEncoding''
parameter of JspServlet.
#Error when compiling, used for jsp line number error messages
-jsp.error.single.line.number=An error occurred at line: {0} in the jsp file:
{1}
+jsp.error.single.line.number=An error occurred at line: [{0}] in the jsp file:
[{1}]
jsp.error.java.line.number=An error occurred at line: [{0}] in the generated
java file: [{1}]
-jsp.error.location=line: {0}, column: {1}
+jsp.error.location=line: [{0}], column: [{1}]
jsp.error.corresponding.servlet=Generated servlet error:\n
-jsp.error.jspbody.required=Must use jsp:body to specify tag body for {0} if
jsp:attribute is used.
-jsp.error.jspbody.emptybody.only=The {0} tag can only have jsp:attribute in
its body.
+jsp.error.jspbody.required=Must use jsp:body to specify tag body for [{0}] if
jsp:attribute is used.
+jsp.error.jspbody.emptybody.only=The [{0}] tag can only have jsp:attribute in
its body.
jsp.error.no.scriptlets=Scripting elements ( <%!, <jsp:declaration,
<%=, <jsp:expression, <%, <jsp:scriptlet ) are disallowed here.
-jsp.error.tld.fn.invalid.signature=Invalid syntax for function signature in
TLD. Tag Library: {0}, Function: {1}
-jsp.error.tld.fn.duplicate.name=Duplicate function name {0} in tag library {1}
-jsp.error.tld.fn.invalid.signature.parenexpected=Invalid syntax for function
signature in TLD. Parenthesis ''('' expected. Tag Library: {0}, Function: {1}.
-jsp.error.tld.mandatory.element.missing=Mandatory TLD element {0} missing or
empty in TLD {1}
-jsp.error.dynamic.attributes.not.implemented=The {0} tag declares that it
accepts dynamic attributes but does not implement the required interface
+jsp.error.tld.fn.invalid.signature=Invalid syntax for function signature in
TLD. Tag Library: [{0}], Function: [{1}]
+jsp.error.tld.fn.duplicate.name=Duplicate function name [{0}] in tag library
[{1}]
+jsp.error.tld.fn.invalid.signature.parenexpected=Invalid syntax for function
signature in TLD. Parenthesis ''('' expected. Tag Library: [{0}], Function:
[{1}].
+jsp.error.tld.mandatory.element.missing=Mandatory TLD element [{0}] missing or
empty in TLD [{1}]
+jsp.error.dynamic.attributes.not.implemented=The [{0}] tag declares that it
accepts dynamic attributes but does not implement the required interface
jsp.error.attribute.noequal=equal symbol expected
jsp.error.attribute.noquote=quote symbol expected
jsp.error.attribute.unterminated=attribute value for [{0}] is not properly
terminated
-jsp.error.attribute.noescape=Attribute value {0} is quoted with {1} which must
be escaped when used within the value
+jsp.error.attribute.noescape=Attribute value [{0}] is quoted with [{1}] which
must be escaped when used within the value
jsp.error.attribute.nowhitespace=The JSP specification requires that an
attribute name is preceded by whitespace
jsp.error.attribute.duplicate=Attribute qualified names must be unique within
an element
-jsp.error.missing.tagInfo=TagInfo object for {0} is missing from TLD
+jsp.error.missing.tagInfo=TagInfo object for [{0}] is missing from TLD
jsp.error.deferredmethodsignaturewithoutdeferredmethod=Cannot specify a method
signature if 'deferredMethod' is not 'true'
jsp.error.deferredvaluetypewithoutdeferredvalue=Cannot specify a value type if
'deferredValue' is not 'true'
jsp.error.deferredmethodandvalue='deferredValue' and 'deferredMethod' cannot
be both 'true'
jsp.error.fragmentwithtype=Cannot specify both 'fragment' and 'type'
attributes. If 'fragment' is present, 'type' is fixed as
'javax.servlet.jsp.tagext.JspFragment'
jsp.error.var_and_varReader=Only one of 'var' or 'varReader' may be specified
jsp.error.missing_var_or_varReader=Missing 'var' or 'varReader' attribute
-jsp.warning.bad.urlpattern.propertygroup=Bad value {0} in the url-pattern
subelement in web.xml
-jsp.error.literal_with_void=A literal value was specified for attribute {0}
that is defined as a deferred method with a return type of void. JSP.2.3.4 does
not permit literal values in this case
-jsp.error.unknown_attribute_type=Unknown attribute type [{1}] for attribute
{0}.
-jsp.error.coerce_to_type=Cannot coerce value [{2}] to type [{1}] for attribute
{0}.
+jsp.warning.bad.urlpattern.propertygroup=Bad value [{0}] in the url-pattern
subelement in web.xml
+jsp.error.literal_with_void=A literal value was specified for attribute [{0}]
that is defined as a deferred method with a return type of void. JSP.2.3.4 does
not permit literal values in this case
+jsp.error.unknown_attribute_type=Unknown attribute type [{1}] for attribute
[{0}].
+jsp.error.coerce_to_type=Cannot coerce value [{2}] to type [{1}] for attribute
[{0}].
jsp.error.jspelement.missing.name=Mandatory XML-style 'name' attribute missing
jsp.error.could.not.add.taglibraries=Could not add one or more tag libraries.
-jsp.error.duplicate.name.jspattribute=The attribute {0} specified in the
standard or custom action also appears as the value of the name attribute in
the enclosed jsp:attribute
-jsp.error.not.in.template={0} not allowed in a template text body.
+jsp.error.duplicate.name.jspattribute=The attribute [{0}] specified in the
standard or custom action also appears as the value of the name attribute in
the enclosed jsp:attribute
+jsp.error.not.in.template=[{0}] not allowed in a template text body.
jsp.error.badStandardAction=Invalid standard action
-jsp.error.xml.badStandardAction=Invalid standard action: {0}
+jsp.error.xml.badStandardAction=Invalid standard action: [{0}]
jsp.error.tagdirective.badbodycontent=Invalid body-content [{0}] in tag
directive
-jsp.error.simpletag.badbodycontent=The TLD for the class {0} specifies an
invalid body-content (JSP) for a SimpleTag.
+jsp.error.simpletag.badbodycontent=The TLD for the class [{0}] specifies an
invalid body-content (JSP) for a SimpleTag.
jsp.error.config_pagedir_encoding_mismatch=Page-encoding specified in
jsp-property-group [{0}] is different from that specified in page directive
[{1}]
jsp.error.prolog_pagedir_encoding_mismatch=Page-encoding specified in XML
prolog [{0}] is different from that specified in page directive [{1}]
jsp.error.prolog_config_encoding_mismatch=Page-encoding specified in XML
prolog [{0}] is different from that specified in jsp-property-group [{1}]
-jsp.error.attribute.custom.non_rt_with_expr=According to TLD or attribute
directive in tag file, attribute {0} does not accept any expressions
-jsp.error.attribute.standard.non_rt_with_expr=The {0} attribute of the {1}
standard action does not accept any expressions
+jsp.error.attribute.custom.non_rt_with_expr=According to TLD or attribute
directive in tag file, attribute [{0}] does not accept any expressions
+jsp.error.attribute.standard.non_rt_with_expr=The [{0}] attribute of the [{1}]
standard action does not accept any expressions
jsp.error.attribute.deferredmix=Cannot use both ${} and #{} EL expressions in
the same attribute value
-jsp.error.scripting.variable.missing_name=Unable to determine scripting
variable name from attribute {0}
-jasper.error.emptybodycontent.nonempty=According to TLD, tag {0} must be
empty, but is not
-jsp.error.tagfile.nameNotUnique=The value of {0} and the value of {1} in line
{2} are the same.
+jsp.error.scripting.variable.missing_name=Unable to determine scripting
variable name from attribute [{0}]
+jasper.error.emptybodycontent.nonempty=According to TLD, tag [{0}] must be
empty, but is not
+jsp.error.tagfile.nameNotUnique=The value of [{0}] and the value of [{1}] in
line [{2}] are the same.
jsp.error.tagfile.nameFrom.noAttribute=Cannot find an attribute directive with
a name attribute with a value [{0}], the value of this name-from-attribute
attribute.
-jsp.error.tagfile.nameFrom.badAttribute=The attribute directive (declared in
line {1} and whose name attribute is [{0}], the value of this
name-from-attribute attribute) must be of type java.lang.String, is "required"
and not a "rtexprvalue".
+jsp.error.tagfile.nameFrom.badAttribute=The attribute directive (declared in
line [{1}] and whose name attribute is [{0}], the value of this
name-from-attribute attribute) must be of type java.lang.String, is "required"
and not a "rtexprvalue".
jsp.error.page.noSession=Cannot access session scope in page that does not
participate in any session
jsp.error.usebean.noSession=Illegal for useBean to use session scope when JSP
page declares (via page directive) that it does not participate in sessions
jsp.error.xml.encodingByteOrderUnsupported = Given byte order for encoding
[{0}] is not supported.
@@ -299,16 +299,16 @@ jsp.error.xml.versionInfoRequired = The
jsp.error.xml.xmlDeclUnterminated = The XML declaration must end with "?>".
jsp.error.xml.reservedPITarget = The processing instruction target matching
"[xX][mM][lL]" is not allowed.
jsp.error.xml.spaceRequiredInPI = White space is required between the
processing instruction target and data.
-jsp.error.xml.invalidCharInContent = An invalid XML character (Unicode: 0x{0})
was found in the element content of the document.
+jsp.error.xml.invalidCharInContent = An invalid XML character (Unicode:
0x[{0}]) was found in the element content of the document.
jsp.error.xml.spaceRequiredBeforeStandalone = White space is required before
the encoding pseudo attribute in the XML declaration.
jsp.error.xml.sdDeclInvalid = The standalone document declaration value must
be "yes" or "no", not [{0}].
-jsp.error.xml.invalidCharInPI = An invalid XML character (Unicode: 0x{0}) was
found in the processing instruction.
+jsp.error.xml.invalidCharInPI = An invalid XML character (Unicode: 0x[{0}])
was found in the processing instruction.
jsp.error.xml.versionNotSupported = XML version [{0}] is not supported, only
XML 1.0 is supported.
jsp.error.xml.pseudoAttrNameExpected = a pseudo attribute name is expected.
-jsp.error.xml.expectedByte = Expected byte {0} of {1}-byte UTF-8 sequence.
-jsp.error.xml.invalidByte = Invalid byte {0} of {1}-byte UTF-8 sequence.
-jsp.error.xml.operationNotSupported = Operation [{0}] not supported by {1}
reader.
-jsp.error.xml.invalidHighSurrogate = High surrogate bits in UTF-8 sequence
must not exceed 0x10 but found 0x{0}.
+jsp.error.xml.expectedByte = Expected byte [{0}] of [{1}]-byte UTF-8 sequence.
+jsp.error.xml.invalidByte = Invalid byte [{0}] of [{1}]-byte UTF-8 sequence.
+jsp.error.xml.operationNotSupported = Operation [{0}] not supported by [{1}]
reader.
+jsp.error.xml.invalidHighSurrogate = High surrogate bits in UTF-8 sequence
must not exceed 0x10 but found 0x[{0}].
jsp.error.xml.invalidASCII = Byte [{0}] not 7-bit ASCII.
jsp.error.xml.spaceRequiredBeforeEncodingInXMLDecl = White space is required
before the encoding pseudo attribute in the XML declaration.
jsp.error.xml.spaceRequiredBeforeEncodingInTextDecl = White space is required
before the encoding pseudo attribute in the text declaration.
@@ -318,21 +318,21 @@ jsp.error.xml.eqRequiredInXMLDecl = The
jsp.error.xml.eqRequiredInTextDecl = The '' = '' character must follow [{0}]
in the text declaration.
jsp.error.xml.quoteRequiredInTextDecl = The value following [{0}] in the text
declaration must be a quoted string.
jsp.error.xml.quoteRequiredInXMLDecl = The value following [{0}] in the XML
declaration must be a quoted string.
-jsp.error.xml.invalidCharInTextDecl = An invalid XML character (Unicode:
0x{0}) was found in the text declaration.
-jsp.error.xml.invalidCharInXMLDecl = An invalid XML character (Unicode: 0x{0})
was found in the XML declaration.
+jsp.error.xml.invalidCharInTextDecl = An invalid XML character (Unicode:
0x[{0}]) was found in the text declaration.
+jsp.error.xml.invalidCharInXMLDecl = An invalid XML character (Unicode:
0x[{0}]) was found in the XML declaration.
jsp.error.xml.closeQuoteMissingInTextDecl = closing quote in the value
following [{0}] in the text declaration is missing.
jsp.error.xml.closeQuoteMissingInXMLDecl = closing quote in the value
following [{0}] in the XML declaration is missing.
jsp.error.multiple.jsp = Cannot have multiple specifications of
-jsp.error.jspoutput.conflict=<jsp:output>: illegal to have multiple
occurrences of [{0}] with different values (old: {1}, new: {2})
+jsp.error.jspoutput.conflict=<jsp:output>: illegal to have multiple
occurrences of [{0}] with different values (old: [{1}], new: [{2}])
jsp.error.jspoutput.doctypenamesystem=<jsp:output>:
'doctype-root-element' and 'doctype-system' attributes must appear together
jsp.error.jspoutput.doctypepublicsystem=<jsp:output>: 'doctype-system'
attribute must appear if 'doctype-public' attribute appears
jsp.error.jspoutput.nonemptybody=<jsp:output> must not have a body
jsp.error.jspoutput.invalidUse=<jsp:output> must not be used in standard
syntax
-jsp.error.attributes.not.allowed = {0} must not have any attributes
-jsp.error.tagfile.badSuffix=Missing ".tag" suffix in tag file path {0}
-jsp.error.tagfile.illegalPath=Illegal tag file path: {0}, must start with
"/WEB-INF/tags" or "/META-INF/tags"
+jsp.error.attributes.not.allowed = [{0}] must not have any attributes
+jsp.error.tagfile.badSuffix=Missing ".tag" suffix in tag file path [{0}]
+jsp.error.tagfile.illegalPath=Illegal tag file path: [{0}], must start with
"/WEB-INF/tags" or "/META-INF/tags"
jsp.error.tagfile.missingPath=Path not specified to tag file
-jsp.error.plugin.wrongRootElement=Name of root element in {0} different from
{1}
+jsp.error.plugin.wrongRootElement=Name of root element in [{0}] different from
[{1}]
jsp.error.attribute.invalidPrefix=The attribute prefix [{0}] does not
correspond to any imported tag library
jsp.error.nested.jspattribute=A jsp:attribute standard action cannot be nested
within another jsp:attribute standard action
jsp.error.nested.jspbody=A jsp:body standard action cannot be nested within
another jsp:body or jsp:attribute standard action
@@ -342,35 +342,35 @@ jsp.error.variable.alias=Both or none of
jsp.error.attribute.null_name=Null attribute name
jsp.error.jsptext.badcontent='<', when appears in the body of
<jsp:text>, must be encapsulated within a CDATA
jsp.error.jsproot.version.invalid=Invalid version number: [{0}], must be
"1.2", "2.0", "2.1", "2.2" or "2.3"
-jsp.error.noFunction=The function {0} cannot be located with the specified
prefix
+jsp.error.noFunction=The function [{0}] cannot be located with the specified
prefix
jsp.error.noFunctionMethod=Method [{0}] for function [{1}] not found in class
[{2}]
-jsp.error.function.classnotfound=The class {0} specified in TLD for the
function {1} cannot be found: {2}
-jsp.error.signature.classnotfound=The class {0} specified in the method
signature in TLD for the function {1} cannot be found. {2}
+jsp.error.function.classnotfound=The class [{0}] specified in TLD for the
function [{1}] cannot be found: [{2}]
+jsp.error.signature.classnotfound=The class [{0}] specified in the method
signature in TLD for the function [{1}] cannot be found. [{2}]
jsp.error.text.has_subelement=<jsp:text> must not have any subelements
jsp.error.data.file.read=Error reading file [{0}]
jsp.error.data.file.processing=Error processing file [{0}]
-jsp.error.prefix.refined=Attempt to redefine the prefix {0} to {1}, when it
was already defined as {2} in the current scope.
+jsp.error.prefix.refined=Attempt to redefine the prefix [{0}] to [{1}], when
it was already defined as [{2}] in the current scope.
jsp.error.nested_jsproot=Nested <jsp:root>
jsp.error.unbalanced.endtag=The end tag "</{0}" is unbalanced
-jsp.error.invalid.bean=The value for the useBean class attribute {0} is
invalid.
-jsp.error.prefix.use_before_dcl=The prefix {0} specified in this tag directive
has been previously used by an action in file {1} line {2}.
+jsp.error.invalid.bean=The value for the useBean class attribute [{0}] is
invalid.
+jsp.error.prefix.use_before_dcl=The prefix [{0}] specified in this tag
directive has been previously used by an action in file [{1}] line [{2}].
jsp.error.lastModified=Unable to determine last modified date for file [{0}]
jsp.info.ignoreSetting=Ignored setting for [{0}] of [{1}] because a
SecurityManager was enabled
-jsp.exception=An exception occurred processing JSP page {0} at line {1}
+jsp.exception=An exception occurred processing JSP page [{0}] at line [{1}]
# JSP 2.1
jsp.error.el.template.deferred=#{...} is not allowed in template text
-jsp.error.el.parse={0} : {1}
+jsp.error.el.parse=[{0}] : [{1}]
jsp.error.page.invalid.deferredsyntaxallowedasliteral=Page directive: invalid
value for deferredSyntaxAllowedAsLiteral
jsp.error.tag.invalid.deferredsyntaxallowedasliteral=Tag directive: invalid
value for deferredSyntaxAllowedAsLiteral
-jsp.error.page.conflict.deferredsyntaxallowedasliteral=Page directive: illegal
to have multiple occurrences of ''deferredSyntaxAllowedAsLiteral'' with
different values (old: {0}, new: {1})
-jsp.error.tag.conflict.deferredsyntaxallowedasliteral=Tag directive: illegal
to have multiple occurrences of ''deferredSyntaxAllowedAsLiteral'' with
different values (old: {0}, new: {1})
+jsp.error.page.conflict.deferredsyntaxallowedasliteral=Page directive: illegal
to have multiple occurrences of ''deferredSyntaxAllowedAsLiteral'' with
different values (old: [{0}], new: [{1}])
+jsp.error.tag.conflict.deferredsyntaxallowedasliteral=Tag directive: illegal
to have multiple occurrences of ''deferredSyntaxAllowedAsLiteral'' with
different values (old: [{0}], new: [{1}])
jsp.error.page.invalid.trimdirectivewhitespaces=Page directive: invalid value
for trimDirectiveWhitespaces
jsp.error.tag.invalid.trimdirectivewhitespaces=Tag directive: invalid value
for trimDirectiveWhitespaces
-jsp.error.page.conflict.trimdirectivewhitespaces=Page directive: illegal to
have multiple occurrences of ''trimDirectiveWhitespaces'' with different values
(old: {0}, new: {1})
-jsp.error.tag.conflict.trimdirectivewhitespaces=Tag directive: illegal to have
multiple occurrences of ''trimDirectiveWhitespaces'' with different values
(old: {0}, new: {1})
+jsp.error.page.conflict.trimdirectivewhitespaces=Page directive: illegal to
have multiple occurrences of ''trimDirectiveWhitespaces'' with different values
(old: [{0}], new: [{1}])
+jsp.error.tag.conflict.trimdirectivewhitespaces=Tag directive: illegal to have
multiple occurrences of ''trimDirectiveWhitespaces'' with different values
(old: [{0}], new: [{1}])
# JSP Servlet
jsp.error.servlet.invalid.method=JSPs only permit GET POST or HEAD
@@ -386,12 +386,12 @@ jsp.error.bug48498=Unable to display JSP
jsp.error.duplicateqname=An attribute with duplicate qualified name [{0}] was
found. Attribute qualified names must be unique within an element.
# JSP unloading handling
-jsp.message.jsp_queue_created=Created jsp queue with length {0} for context
[{1}]
+jsp.message.jsp_queue_created=Created jsp queue with length [{0}] for context
[{1}]
jsp.message.jsp_added=Adding JSP for path [{0}] to queue of context [{1}]
jsp.message.jsp_queue_update=Updating JSP for path [{0}] in queue of context
[{1}]
jsp.message.jsp_removed_excess=Removing excess JSP for path [{0}] from queue
of context [{1}]
-jsp.message.jsp_removed_idle=Removing idle JSP for path [{0}] in context [{1}]
after {2} seconds");
-jsp.message.jsp_unload_check=Checking JSPs for unload in context [{0}], JSP
count: {1} queue length: {2}
+jsp.message.jsp_removed_idle=Removing idle JSP for path [{0}] in context [{1}]
after [{2}] seconds");
+jsp.message.jsp_unload_check=Checking JSPs for unload in context [{0}], JSP
count: [{1}] queue length: [{2}]
xmlParser.skipBomFail=Failed to skip BOM when parsing XML input stream
@@ -412,6 +412,6 @@ org.apache.jasper.compiler.ELParser.inva
org.apache.jasper.compiler.TldCache.servletContextNull=The provided
ServletContext was null
org.apache.jasper.servlet.JasperInitializer.onStartup=Initializing Jasper for
context [{0}]
-org.apache.jasper.servlet.TldScanner.webxmlSkip=Skipping load of TLD for URI
{1} from resource path {0} as it has already been defined in <jsp-config>
-org.apache.jasper.servlet.TldScanner.webxmlAdd=Loading TLD for URI {1} from
resource path {0}
+org.apache.jasper.servlet.TldScanner.webxmlSkip=Skipping load of TLD for URI
[{1}] from resource path [{0}] as it has already been defined in <jsp-config>
+org.apache.jasper.servlet.TldScanner.webxmlAdd=Loading TLD for URI [{1}] from
resource path [{0}]
org.apache.jasper.servlet.TldScanner.webxmlFailPathDoesNotExist=Failed to
process TLD with path [{0}] and URI [{1}]. The specified path does not exist.
Modified:
tomcat/trunk/java/org/apache/jasper/resources/LocalStrings_es.properties
URL:
http://svn.apache.org/viewvc/tomcat/trunk/java/org/apache/jasper/resources/LocalStrings_es.properties?rev=1789476&r1=1789475&r2=1789476&view=diff
==============================================================================
--- tomcat/trunk/java/org/apache/jasper/resources/LocalStrings_es.properties
(original)
+++ tomcat/trunk/java/org/apache/jasper/resources/LocalStrings_es.properties
Thu Mar 30 09:20:56 2017
@@ -19,64 +19,64 @@ jsp.error.compiler = No hay compilador J
jsp.error.no.scratch.dir = El motor JSP no tiene configurado un directorio de
trabajo.\n\
\ A\u00F1ada "jsp.initparams=scratchdir=<dir-name>" \n\
\ en el fichero servlets.properties para este contexto.
-jsp.error.bad.scratch.dir = El directorio de trabajo especificado: {0} no es
utilizable.
-jsp.message.scratch.dir.is = El directorio de trabajo para el motor JSP es: {0}
-jsp.message.parent_class_loader_is = El cargador de clases es: {0}
+jsp.error.bad.scratch.dir = El directorio de trabajo especificado: [{0}] no es
utilizable.
+jsp.message.scratch.dir.is = El directorio de trabajo para el motor JSP es:
[{0}]
+jsp.message.parent_class_loader_is = El cargador de clases es: [{0}]
jsp.message.dont.modify.servlets = IMPORTANTE: No modifique los servlets
generados
jsp.error.unavailable = JSP ha sido marcado como no disponible
-jsp.error.usebean.duplicate = useBean: Nombre de bean duplicado: {0}
-jsp.error.invalid.scope = Valor ilegal de atributo ''scope'': {0} (debe de ser
uno de "page", "request", "session", o "application")
+jsp.error.usebean.duplicate = useBean: Nombre de bean duplicado: [{0}]
+jsp.error.invalid.scope = Valor ilegal de atributo ''scope'': [{0}] (debe de
ser uno de "page", "request", "session", o "application")
jsp.error.classname = No pude determinar el nombre de clase desde el fichero
.class
jsp.error.outputfolder = no hay carpeta de salida
jsp.error.data.file.write = Error mientras escrib\u00EDa el archivo de datos
-jsp.error.page.conflict.contenttype = Directiva Page: es ilegal tener
m\u00FAltiples ocurrencias de ''contentType'' con valores distintos (viejo:
{0}, nuevo: {1})
-jsp.error.page.conflict.session = Directiva Page: es ilegal tener
m\u00FAltiples ocurrencias de ''session'' con valores distintos (viejo: {0},
nuevo: {1})
+jsp.error.page.conflict.contenttype = Directiva Page: es ilegal tener
m\u00FAltiples ocurrencias de ''contentType'' con valores distintos (viejo:
[{0}], nuevo: [{1}])
+jsp.error.page.conflict.session = Directiva Page: es ilegal tener
m\u00FAltiples ocurrencias de ''session'' con valores distintos (viejo: [{0}],
nuevo: [{1}])
jsp.error.page.invalid.session = Directiva Page: valor incorrecto para session
-jsp.error.page.conflict.buffer = Directiva Page: es ilegal tener
m\u00FAltiples ocurrencias de ''buffer'' con valores distintos (viejo: {0},
nuevo: {1})
+jsp.error.page.conflict.buffer = Directiva Page: es ilegal tener
m\u00FAltiples ocurrencias de ''buffer'' con valores distintos (viejo: [{0}],
nuevo: [{1}])
jsp.error.page.invalid.buffer = Directiva Page: valor incorrecto para
b\u00FAfer
-jsp.error.page.conflict.autoflush = Directiva Page: es ilegal tener
m\u00FAltiples ocurrencias de ''autoFlush'' con valores distintos (viejo: {0},
nuevo: {1})
-jsp.error.page.conflict.isthreadsafe = Directiva Page: es ilegal tener
m\u00FAltiples ocurrencias de ''isThreadSafe'' con valores distintos (viejo:
{0}, nuevo: {1})
+jsp.error.page.conflict.autoflush = Directiva Page: es ilegal tener
m\u00FAltiples ocurrencias de ''autoFlush'' con valores distintos (viejo:
[{0}], nuevo: [{1}])
+jsp.error.page.conflict.isthreadsafe = Directiva Page: es ilegal tener
m\u00FAltiples ocurrencias de ''isThreadSafe'' con valores distintos (viejo:
[{0}], nuevo: [{1}])
jsp.error.page.invalid.isthreadsafe = =Directiva Page: valor incorrecto para
isThreadSafe
-jsp.error.page.conflict.info = Directiva Page: es ilegal tener m\u00FAltiples
ocurrencias de ''info'' con valores distintos (viejo: {0}, nuevo: {1})
+jsp.error.page.conflict.info = Directiva Page: es ilegal tener m\u00FAltiples
ocurrencias de ''info'' con valores distintos (viejo: [{0}], nuevo: [{1}])
jsp.error.page.invalid.info = =Directiva Page: valor incorrecto para info
-jsp.error.page.conflict.iserrorpage = Directiva Page: es ilegal tener
m\u00FAltiples ocurrencias de ''isErrorPage'' con valores distintos (viejo:
{0}, nuevo: {1})
+jsp.error.page.conflict.iserrorpage = Directiva Page: es ilegal tener
m\u00FAltiples ocurrencias de ''isErrorPage'' con valores distintos (viejo:
[{0}], nuevo: [{1}])
jsp.error.page.invalid.iserrorpage = =Directiva Page: valor incorrecto para
isErrorPage
-jsp.error.page.conflict.errorpage = Directiva Page: es ilegal tener
m\u00FAltiples ocurrencias de ''errorPage'' con valores distintos (viejo: {0},
nuevo: {1})
-jsp.error.page.conflict.language = Directiva Page: es ilegal tener
m\u00FAltiples ocurrencias de ''language'' con valores distintos (viejo: {0},
nuevo: {1})
-jsp.error.tag.conflict.language = Directiva Tag: es ilegal tener
m\u00FAltiples ocurrencias de ''language'' con valores distintos (viejo: {0},
nuevo: {1})
+jsp.error.page.conflict.errorpage = Directiva Page: es ilegal tener
m\u00FAltiples ocurrencias de ''errorPage'' con valores distintos (viejo:
[{0}], nuevo: [{1}])
+jsp.error.page.conflict.language = Directiva Page: es ilegal tener
m\u00FAltiples ocurrencias de ''language'' con valores distintos (viejo: [{0}],
nuevo: [{1}])
+jsp.error.tag.conflict.language = Directiva Tag: es ilegal tener
m\u00FAltiples ocurrencias de ''language'' con valores distintos (viejo: [{0}],
nuevo: [{1}])
jsp.error.page.language.nonjava = Directiva Page: atributo language incorrecto
jsp.error.tag.language.nonjava = Directiva Tag: atributo language incorrecto
-jsp.error.page.conflict.extends = Directiva Page: es ilegal tener
m\u00FAltiples ocurrencias de ''extends'' con valores distintos (viejo: {0},
nuevo: {1})
-jsp.error.page.conflict.iselignored = Directiva Page: es ilegal tener
m\u00FAltiples ocurrencias de ''isELIgnored'' con valores distintos (viejo:
{0}, nuevo: {1})
-jsp.error.tag.conflict.iselignored = Directiva Tag: es ilegal tener
m\u00FAltiples ocurrencias de ''isELIgnored'' con valores distintos (viejo:
{0}, nuevo: {1})
+jsp.error.page.conflict.extends = Directiva Page: es ilegal tener
m\u00FAltiples ocurrencias de ''extends'' con valores distintos (viejo: [{0}],
nuevo: [{1}])
+jsp.error.page.conflict.iselignored = Directiva Page: es ilegal tener
m\u00FAltiples ocurrencias de ''isELIgnored'' con valores distintos (viejo:
[{0}], nuevo: [{1}])
+jsp.error.tag.conflict.iselignored = Directiva Tag: es ilegal tener
m\u00FAltiples ocurrencias de ''isELIgnored'' con valores distintos (viejo:
[{0}], nuevo: [{1}])
jsp.error.page.invalid.iselignored = Directiva Page: valor inv\u00E1lido para
isELIgnored
jsp.error.tag.invalid.iselignored = Directiva Tag: valor incorrecto para
isELIgnored
jsp.error.page.multi.pageencoding = La directiva Page no debe de tener
m\u00FAltiples ocurrencias de pageencoding
-jsp.error.tag.conflict.attr = Directiva Tag: es ilegal tener m\u00FAltiples
ocurrencias del atributo [{0}] con valores distintos (viejo: {1}, nuevo: {2})
+jsp.error.tag.conflict.attr = Directiva Tag: es ilegal tener m\u00FAltiples
ocurrencias del atributo [{0}] con valores distintos (viejo: [{1}], nuevo:
[{2}])
jsp.error.tag.multi.pageencoding = La directiva Tag no debe de tener
m\u00FAltiples ocurrencias de pageencoding
-jsp.error.include.exception = No se puede incluir {0}
+jsp.error.include.exception = No se puede incluir [{0}]
jsp.error.stream.close.failed = No pude cerrar el flujo
jsp.error.stream.closed = Stream cerrado
jsp.error.invalid.directive = Directiva no v\u00E1lida
-jsp.error.invalid.implicit = TLD impl\u00EDcito inv\u00E1lido para fichero de
marca en {0}
-jsp.error.invalid.implicit.version = Versi\u00F3n inv\u00E1lida de JSP
definida en TLD impl\u00EDcito para fichero de marca en {0}
-jsp.error.invalid.version = Versi\u00F3n inv\u00E1lida de JSP definida para
fichero de marca en {0}
-jsp.error.directive.istagfile = La Directiva {0} no puede usarse en archivo de
tag
-jsp.error.directive.isnottagfile = La Directiva {0} s\u00F3lo se puede usar en
un archivo de tag
-jsp.error.action.istagfile = La acci\u00F3n {0} no se puede usar en un archivo
tag
-jsp.error.action.isnottagfile = La acci\u00F3n {0} s\u00F3lo se puede usar en
archivos tag
-jsp.error.unterminated = Tag {0} no terminado
-jsp.error.loadclass.taghandler = No se puede cargar la clase {0}
+jsp.error.invalid.implicit = TLD impl\u00EDcito inv\u00E1lido para fichero de
marca en [{0}]
+jsp.error.invalid.implicit.version = Versi\u00F3n inv\u00E1lida de JSP
definida en TLD impl\u00EDcito para fichero de marca en [{0}]
+jsp.error.invalid.version = Versi\u00F3n inv\u00E1lida de JSP definida para
fichero de marca en [{0}]
+jsp.error.directive.istagfile = La Directiva [{0}] no puede usarse en archivo
de tag
+jsp.error.directive.isnottagfile = La Directiva [{0}] s\u00F3lo se puede usar
en un archivo de tag
+jsp.error.action.istagfile = La acci\u00F3n [{0}] no se puede usar en un
archivo tag
+jsp.error.action.isnottagfile = La acci\u00F3n [{0}] s\u00F3lo se puede usar
en archivos tag
+jsp.error.unterminated = Tag [{0}] no terminado
+jsp.error.loadclass.taghandler = No se puede cargar la clase [{0}]
jsp.error.unable.compile = No se puede compilar la clase para JSP
jsp.error.unable.load = No se puede cargar la clase para JSP
-jsp.error.mandatory.attribute = {0}: Falta atributo obligatorio {1}
+jsp.error.mandatory.attribute = [{0}]: Falta atributo obligatorio [{1}]
jsp.error.flush = Excepci\u00F3n sucedida al vaciar los datos
jsp.engine.info = Motor Jasper JSP 2.3
-jsp.error.invalid.expression = [{0}] contiene expresiones incorrectas: {1}
-jsp.error.invalid.attribute = {0}: Atributo incorrecto, {1}
-jsp.error.file.cannot.read = No se puede leer el archivo: {0}
-jsp.error.file.already.registered = El archivo {0} ya se ha visto,
\u00BFpodr\u00EDa ser un include recursivo?
-jsp.error.file.not.registered = Archivo {0} not visto en include
+jsp.error.invalid.expression = [{0}] contiene expresiones incorrectas: [{1}]
+jsp.error.invalid.attribute = [{0}]: Atributo incorrecto, [{1}]
+jsp.error.file.cannot.read = No se puede leer el archivo: [{0}]
+jsp.error.file.already.registered = El archivo [{0}] ya se ha visto,
\u00BFpodr\u00EDa ser un include recursivo?
+jsp.error.file.not.registered = Archivo [{0}] not visto en include
jsp.error.quotes.unterminated = Comillas no terminadas
jsp.error.attr.quoted = El valor del atributo deber\u00EDa ir entre comillas
jsp.error.beans.nullbean = Se ha intentado una operaci\u00F3n de bean en un
objeto nulo
@@ -84,7 +84,7 @@ jsp.error.beans.nobeaninfo = No se puede
jsp.error.beans.nomethod = No puedo encontrar un m\u00E9todo para leer la
propiedad [{0}] en un bean del tipo [{1}]
jsp.error.beans.nomethod.setproperty = No puedo encontrar un m\u00E9todo para
escribir la propiedad [{0}] en un bean del tipo [{2}]
jsp.error.beans.noproperty = No puedo encontrar informaci\u00F3n de la
propiedad [{0}] en un bean del tipo [{1}]
-jsp.error.beans.property.conversion = No puedo convertir cadena [{0}] a clase
[{1}] para atributo [{2}]: {3}
+jsp.error.beans.property.conversion = No puedo convertir cadena [{0}] a clase
[{1}] para atributo [{2}]: [{3}]
jsp.error.beans.propertyeditor.notregistered = Editor de Propiedades no
registrado con el PropertyEditorManager
jsp.error.beans.setproperty.noindexset = No puedo poner la propiedad indexada
jsp.error.include.tag = Tag jsp:include no v\u00E1lido
@@ -103,7 +103,7 @@ jsp.error.plugin.nocode = C\u00F3digo no
jsp.error.ise_on_clear = Es ilegal usar clear() cuando el tama\u00F1o del
buffer es cero
jsp.error.javac = Excepci\u00F3n de Javac
jsp.error.javac.env = Entorno
-jsp.error.compilation = Error compilando fichero: {0} {1}
+jsp.error.compilation = Error compilando fichero: [{0}] [{1}]
jsp.error.undeclared_namespace = Se ha encontrado una etiqueta con espacio de
nombre [{0}] sin declarar
jsp.warning.keepgen = Aviso: valor incorrecto para el initParam keepgen. Se
usar\u00E1 el valor por defecto de "false"
jsp.warning.xpoweredBy = Aviso: valor incorrecto para el initParam xpoweredBy.
Se usar\u00E1 el valor por defecto de "false"
@@ -129,16 +129,16 @@ jsp.warning.unknown.element.in.variable
jsp.warning.unknown.element.in.validator = Elemento desconocido [{0}] en
validator
jsp.warning.unknown.element.in.initParam = Elemento desconocido [{0}] en
init-param de validator
jsp.warning.unknown.element.in.function = Elemento desconocido [{0}] en
function
-jsp.error.teiclass.instantiation = No se puede cargar la clase TagExtraInfo
llamada: {0}
-jsp.error.non_null_tei_and_var_subelems = Tag {0} tiene uno o m\u00E1s
subelementos variable y una clase TagExtraInfo que devuelve una o m\u00E1s
VariableInfo
-jsp.error.parse.error.in.TLD = Error de an\u00E1lisis en el descriptor de
biblioteca de tags: {0}
+jsp.error.teiclass.instantiation = No se puede cargar la clase TagExtraInfo
llamada: [{0}]
+jsp.error.non_null_tei_and_var_subelems = Tag [{0}] tiene uno o m\u00E1s
subelementos variable y una clase TagExtraInfo que devuelve una o m\u00E1s
VariableInfo
+jsp.error.parse.error.in.TLD = Error de an\u00E1lisis en el descriptor de
biblioteca de tags: [{0}]
jsp.error.file.not.found = Archivo JSP [{0}] no encontrado
-jsp.error.missing_attribute = De acuerdo con el TLD el atributo {0} es
obligatorio para el tag {1}
-jsp.error.bad_attribute = El atributo {0} no es v\u00E1lido seg\u00FAn el TLD
especificado
-jsp.error.tld.unable_to_get_jar = Imposible obtener recurso JAR [{0}]
conteniendo TLD: {1}
+jsp.error.missing_attribute = De acuerdo con el TLD el atributo [{0}] es
obligatorio para el tag [{1}]
+jsp.error.bad_attribute = El atributo [{0}] no es v\u00E1lido seg\u00FAn el
TLD especificado
+jsp.error.tld.unable_to_get_jar = Imposible obtener recurso JAR [{0}]
conteniendo TLD: [{1}]
jsp.error.tld.missing_jar = Falta recurso JAR [{0}] conteniendo TLD
-jsp.error.unable.to_find_method = No se puede encontrar el m\u00E9todo de
escritura para el atributo: {0}
-jsp.error.bad_tag = No existe el tag {0} en la biblioteca importada con
prefijo {1}
+jsp.error.unable.to_find_method = No se puede encontrar el m\u00E9todo de
escritura para el atributo: [{0}]
+jsp.error.bad_tag = No existe el tag [{0}] en la biblioteca importada con
prefijo [{1}]
jsp.error.xml.bad_tag = No se ha definido el tag [{0}] en la biblioteca tag
asociada con uri [{1}]
jsp.warning.compiler.classfile.delete.fail = No pude borrar el fichero
generado de clase [{0}]
jsp.warning.compiler.classfile.delete.fail.unknown = No pude borrar los
ficheros generados de clase
@@ -211,74 +211,74 @@ jspc.webinc.insertStart = <!-- Inicio de
jspc.error.generalException = ERROR-el archivo [{0}] ha generado la
excepci\u00F3n general siguiente:
jspc.error.fileDoesNotExist = El archivo [{0}] utilizado como argumento no
existe.
jspc.delete.fail = No pude borrar el fichero [{0}]
-jsp.error.library.invalid = La p\u00E1gina JSP es incorrecta de acuerdo a la
biblioteca {0}: {1}
-jsp.error.tlvclass.instantiation = No pude cargar o instanciar clase
TagLibraryValidator: {0}
-jsp.error.tlv.invalid.page = Mensajes de error de validaci\u00F3n desde
TagLibraryValidator para {0} in {1}
-jsp.error.tei.invalid.attributes = Mensajes de error de validaci\u00F3n desde
TagExtraInfo para {0}
+jsp.error.library.invalid = La p\u00E1gina JSP es incorrecta de acuerdo a la
biblioteca [{0}]: [{1}]
+jsp.error.tlvclass.instantiation = No pude cargar o instanciar clase
TagLibraryValidator: [{0}]
+jsp.error.tlv.invalid.page = Mensajes de error de validaci\u00F3n desde
TagLibraryValidator para [{0}] in [{1}]
+jsp.error.tei.invalid.attributes = Mensajes de error de validaci\u00F3n desde
TagExtraInfo para [{0}]
jsp.error.no.more.content = Alcanzado fin de contenido mietras se
requer\u00EDa m\u00E1s an\u00E1lisis: \u00BFerror de anidamiento de tag?
-jsp.error.parse.xml = Error de an\u00E1lisis XML en archivo {0}
-jsp.error.parse.xml.line = Error de an\u00E1lisis XML en archivo {0}:
(l\u00EDnea {1}, col {2})
-jsp.error.parse.xml.scripting.invalid.body = El cuerpo de elemento {0} no debe
de contener elementos XML
-jsp.error.internal.tldinit = No pude inicializar TldLocationsCache: {0}
-jsp.error.internal.filenotfound = Error Interno: Archivo {0} no hallado
-jsp.error.parse.xml.invalidPublicId = PUBLIC ID incorrecta: {0}
-jsp.error.unsupported.encoding = Codificaci\u00F3n no soportada: {0}
-jsp.error.taglibDirective.absUriCannotBeResolved = La uri absoluta: {0} no
puede resolverse o en web.xml o el los archivos jar desplegados con esta
aplicaci\u00F3n
+jsp.error.parse.xml = Error de an\u00E1lisis XML en archivo [{0}]
+jsp.error.parse.xml.line = Error de an\u00E1lisis XML en archivo [{0}]:
(l\u00EDnea [{1}], col [{2}])
+jsp.error.parse.xml.scripting.invalid.body = El cuerpo de elemento [{0}] no
debe de contener elementos XML
+jsp.error.internal.tldinit = No pude inicializar TldLocationsCache: [{0}]
+jsp.error.internal.filenotfound = Error Interno: Archivo [{0}] no hallado
+jsp.error.parse.xml.invalidPublicId = PUBLIC ID incorrecta: [{0}]
+jsp.error.unsupported.encoding = Codificaci\u00F3n no soportada: [{0}]
+jsp.error.taglibDirective.absUriCannotBeResolved = La uri absoluta: [{0}] no
puede resolverse o en web.xml o el los archivos jar desplegados con esta
aplicaci\u00F3n
jsp.error.taglibDirective.missing.location = No se ha especificado ni el
atributo 'uri' ni el 'tagdir'
jsp.error.taglibDirective.both_uri_and_tagdir = Se han especificado ambos
atributos 'uri' y 'tagdir'
-jsp.error.invalid.tagdir = El directorio de archivo Tag {0} no comienza con
"/WEB-INF/tags"
-#jspx.error.templateDataNotInJspCdata=Validation Error: Element <{0}>
cannot have template data. Template data must be encapsulated within a
<jsp:cdata> element. [JSP1.2 PFD section 5.1.9]\nTemplate data in error:
{1}
-#Error while processing taglib jar file {0}: {1}
-jsp.error.needAlternateJavaEncoding = La codificaci\u00F3n java por defecto
{0} es incorrecta en tu plataforma java. Se puede especificar una alternativa
v\u00EDa par\u00E1metro ''javaEncoding'' de JspServlet.
+jsp.error.invalid.tagdir = El directorio de archivo Tag [{0}] no comienza con
"/WEB-INF/tags"
+#jspx.error.templateDataNotInJspCdata=Validation Error: Element <{0}>
cannot have template data. Template data must be encapsulated within a
<jsp:cdata> element. [JSP1.2 PFD section 5.1.9]\nTemplate data in error:
[{1}]
+#Error while processing taglib jar file [{0}]: [{1}]
+jsp.error.needAlternateJavaEncoding = La codificaci\u00F3n java por defecto
[{0}] es incorrecta en tu plataforma java. Se puede especificar una alternativa
v\u00EDa par\u00E1metro ''javaEncoding'' de JspServlet.
#Error when compiling, used for jsp line number error messages
-jsp.error.single.line.number = Ha tenido lugar un error en la l\u00EDnea: {0}
en el archivo jsp: {1}
+jsp.error.single.line.number = Ha tenido lugar un error en la l\u00EDnea:
[{0}] en el archivo jsp: [{1}]
jsp.error.java.line.number = Ha tenido lugar un error en la l\u00EDnea: [{0}]
en el fichero java generado: [{1}]
-jsp.error.location = l\u00EDnea: {0}, columna: {1}
+jsp.error.location = l\u00EDnea: [{0}], columna: [{1}]
jsp.error.corresponding.servlet = Error de servlet generado:\n
-jsp.error.jspbody.required = Se debe de usar jsp:body para especificar cuerpo
tag para {0} si se usa jsp:attribute.
-jsp.error.jspbody.emptybody.only = El tag {0} s\u00F3lo puede tener
jsp:attribute en su cuerpo.
+jsp.error.jspbody.required = Se debe de usar jsp:body para especificar cuerpo
tag para [{0}] si se usa jsp:attribute.
+jsp.error.jspbody.emptybody.only = El tag [{0}] s\u00F3lo puede tener
jsp:attribute en su cuerpo.
jsp.error.no.scriptlets = Los elementos de Scripting (<%!,
<jsp:declaration, <%=, <jsp:expression, <%, <jsp:scriptlet ) no
est\u00E1n permitidos aqu\u00ED.
-jsp.error.tld.fn.invalid.signature = Sint\u00E1xis incorrecta para firma de
funci\u00F3n en TLD. Biblioteca de Tag: {0}, Funci\u00F3n: {1}
-jsp.error.tld.fn.duplicate.name = Nombre duplicado de funci\u00F3n {0} en
biblioteca de tag {1}
-jsp.error.tld.fn.invalid.signature.parenexpected = Sint\u00E1xis incorrecta
para firma de funci\u00F3n en TLD. Se esperaba Par\u00E9ntesis ''(''.
Biblioteca de Tag: {0}, Funci\u00F3n: {1}.
-jsp.error.tld.mandatory.element.missing = Falta o est\u00E1 vac\u00EDo
elemento TLD obligatorio: {0}
-jsp.error.dynamic.attributes.not.implemented = El tag {0} declara que acepta
atributos din\u00E1micos pero no implementa la interfaz requerida
+jsp.error.tld.fn.invalid.signature = Sint\u00E1xis incorrecta para firma de
funci\u00F3n en TLD. Biblioteca de Tag: [{0}], Funci\u00F3n: [{1}]
+jsp.error.tld.fn.duplicate.name = Nombre duplicado de funci\u00F3n [{0}] en
biblioteca de tag [{1}]
+jsp.error.tld.fn.invalid.signature.parenexpected = Sint\u00E1xis incorrecta
para firma de funci\u00F3n en TLD. Se esperaba Par\u00E9ntesis ''(''.
Biblioteca de Tag: [{0}], Funci\u00F3n: [{1}].
+jsp.error.tld.mandatory.element.missing = Falta o est\u00E1 vac\u00EDo
elemento TLD obligatorio: [{0}]
+jsp.error.dynamic.attributes.not.implemented = El tag [{0}] declara que acepta
atributos din\u00E1micos pero no implementa la interfaz requerida
jsp.error.attribute.noequal = se esperaba s\u00EDmbolo igual
jsp.error.attribute.noquote = se esperaba s\u00EDmbolo comillas
-jsp.error.attribute.unterminated = el atributo para {0} no est\u00E1 terminado
correctamente
-jsp.error.attribute.noescape = El valor de atributo {0} est\u00E1
entrecomillado con {1} que debe de usar escape al usarse dentro del valor
+jsp.error.attribute.unterminated = el atributo para [{0}] no est\u00E1
terminado correctamente
+jsp.error.attribute.noescape = El valor de atributo [{0}] est\u00E1
entrecomillado con [{1}] que debe de usar escape al usarse dentro del valor
jsp.error.attribute.nowhitespace = La especificaci\u00F3n JSP requiere que un
nombre de atributo sea precedido por un espacio en blanco
jsp.error.attribute.duplicate = Los nombre cualificados de atributo deben de
ser \u00FAnicos dentro de un elemento
-jsp.error.missing.tagInfo = El objeto TagInfo para {0} falta del TLD
+jsp.error.missing.tagInfo = El objeto TagInfo para [{0}] falta del TLD
jsp.error.deferredmethodsignaturewithoutdeferredmethod = No puedo especificar
firma de m\u00E9todo si 'deferredMethod' no es 'verdadero'
jsp.error.deferredvaluetypewithoutdeferredvalue = No puedo especificar un tipo
de valor si 'deferredValue' no es 'verdadero'
jsp.error.deferredmethodandvalue = 'deferredValue' y 'deferredMethod' no
pueden ser ambos 'verdadero'
jsp.error.fragmentwithtype = No puede especificar ambos atributos 'fragment' y
'type'. Si est\u00E1 presente 'fragment', 'type' se pone como
'javax.servlet.jsp.tagext.JspFragment'
jsp.error.var_and_varReader = S\u00F3lo se puede especificar uno de 'var' o
'varReader'
jsp.error.missing_var_or_varReader = Falta atributo 'var' o 'varReader'
-jsp.warning.bad.urlpattern.propertygroup = Valor malo {0} en el subelemento
url-pattern en web.xml
-jsp.error.literal_with_void = Se especific\u00F3 un valor literal para el
atributo {0} que est\u00E1 definido como un m\u00E9todo diferido con un tipo
nulo de retorno. JSP.2.3.4 no permite valores de literal en este caso
-jsp.error.unknown_attribute_type = Tipo de atributo desconocido [{1}] para
atributo {0}.
-jsp.error.coerce_to_type = No puedo coaccionar el valor [{2}] a tipo [{1}]
para atributo {0}.
+jsp.warning.bad.urlpattern.propertygroup = Valor malo [{0}] en el subelemento
url-pattern en web.xml
+jsp.error.literal_with_void = Se especific\u00F3 un valor literal para el
atributo [{0}] que est\u00E1 definido como un m\u00E9todo diferido con un tipo
nulo de retorno. JSP.2.3.4 no permite valores de literal en este caso
+jsp.error.unknown_attribute_type = Tipo de atributo desconocido [{1}] para
atributo [{0}].
+jsp.error.coerce_to_type = No puedo coaccionar el valor [{2}] a tipo [{1}]
para atributo [{0}].
jsp.error.jspelement.missing.name = Falta atributo obligatorio XML-style 'name'
jsp.error.could.not.add.taglibraries = No pude a\u00F1adir una o m\u00E1s
bibliotecas.
-jsp.error.duplicate.name.jspattribute = El atributo {0} especificado en la
acci\u00F3n standard o custom tambi\u00E9n aparece como el valor del atributo
name en jsp:attribute
-jsp.error.not.in.template = {0} no permitido en una plantilla cuerpo de texto.
+jsp.error.duplicate.name.jspattribute = El atributo [{0}] especificado en la
acci\u00F3n standard o custom tambi\u00E9n aparece como el valor del atributo
name en jsp:attribute
+jsp.error.not.in.template = [{0}] no permitido en una plantilla cuerpo de
texto.
jsp.error.badStandardAction = Acci\u00F3n est\u00E1ndar incorrecta
-jsp.error.xml.badStandardAction = Acci\u00F3n est\u00E1ndar incorrecta: {0}
+jsp.error.xml.badStandardAction = Acci\u00F3n est\u00E1ndar incorrecta: [{0}]
jsp.error.tagdirective.badbodycontent = body-content incorrecto [{0}] en
directiva tag
-jsp.error.simpletag.badbodycontent = El TLD para la clase {0} especifica un
body-content es incorrecto (JSP) para un SimpleTag.
+jsp.error.simpletag.badbodycontent = El TLD para la clase [{0}] especifica un
body-content es incorrecto (JSP) para un SimpleTag.
jsp.error.config_pagedir_encoding_mismatch = El Page-encoding especificado en
jsp-property-group [{0}] es diferente del especificado en la diectiva page [{1}]
jsp.error.prolog_pagedir_encoding_mismatch = El Page-encoding especificado en
XML prolog [{0}] difiere del especificado en la directiva page [{1}]
jsp.error.prolog_config_encoding_mismatch = El Page-encoding especificado en
XML prolog [{0}] difiere del especificado en jsp-property-group [{1}]
-jsp.error.attribute.custom.non_rt_with_expr = Seg\u00FAn el TLD o la directiva
attribute del archivo tag, el atributo {0} no acepta expresiones
-jsp.error.attribute.standard.non_rt_with_expr = El atributo {0} de la
acci\u00F3n est\u00E1ndar {1} no acepta expresiones
+jsp.error.attribute.custom.non_rt_with_expr = Seg\u00FAn el TLD o la directiva
attribute del archivo tag, el atributo [{0}] no acepta expresiones
+jsp.error.attribute.standard.non_rt_with_expr = El atributo [{0}] de la
acci\u00F3n est\u00E1ndar [{1}] no acepta expresiones
jsp.error.attribute.deferredmix = No puedo sar ambas espresiones EL ${} y #{}
en el mismo valor de atributo
-jsp.error.scripting.variable.missing_name = Imposible determinar nombre de
variable de scripting desde atributo {0}
-jasper.error.emptybodycontent.nonempty = Seg\u00FAn el TLD, el tag {0} debe de
estar vac\u00EDo, pero no lo est\u00E1
-jsp.error.tagfile.nameNotUnique = El valor de {0} y el valor de {1} en la
l\u00EDnea {2} son el mismo.
+jsp.error.scripting.variable.missing_name = Imposible determinar nombre de
variable de scripting desde atributo [{0}]
+jasper.error.emptybodycontent.nonempty = Seg\u00FAn el TLD, el tag [{0}] debe
de estar vac\u00EDo, pero no lo est\u00E1
+jsp.error.tagfile.nameNotUnique = El valor de [{0}] y el valor de [{1}] en la
l\u00EDnea [{2}] son el mismo.
jsp.error.tagfile.nameFrom.noAttribute = No puedo hallar una directiva
attribute con un atributo name con un valor [{0}], el valor de este atributo
name-from-attribute.
-jsp.error.tagfile.nameFrom.badAttribute = La directiva attribute (declarada en
la l\u00EDnea {1} y cuyo atributo name es [{0}], el valor de este atributo
name-from-attribute attribute) debe de ser del tipo java.lang.String, es
"required" y no un "rtexprvalue".
+jsp.error.tagfile.nameFrom.badAttribute = La directiva attribute (declarada en
la l\u00EDnea [{1}] y cuyo atributo name es [{0}], el valor de este atributo
name-from-attribute attribute) debe de ser del tipo java.lang.String, es
"required" y no un "rtexprvalue".
jsp.error.page.noSession = No puedo acceder al \u00E1mbito de sesi\u00F3n en
una p\u00E1gina que no participa en una sesi\u00F3n
jsp.error.usebean.noSession = Es ilegal para useBean el usar \u00E1mbito de
sesi\u00F3n cuando la p\u00E1gina JSP declara (v\u00EDa directiva de
p\u00E1gina) que no participa en sesiones
jsp.error.xml.encodingByteOrderUnsupported = El orden de byte dado para
encoding [{0}] no est\u00E1 soportado
@@ -290,16 +290,16 @@ jsp.error.xml.versionInfoRequired = Se r
jsp.error.xml.xmlDeclUnterminated = La declaraci\u00F3n XML debe de terminar
con "?>".
jsp.error.xml.reservedPITarget = La instrucci\u00F3n de procesamiento que
coincide con "[xX][mM][lL]" no est\u00E1 permitida.
jsp.error.xml.spaceRequiredInPI = Se necesita un espacio en blanco entre la
instrucci\u00F3n de procesamiento y los datos.
-jsp.error.xml.invalidCharInContent = Un car\u00E1cter XML incorrecto (Unicode:
0x{0}) se hall\u00F3 en el contenido del elemento del documento.
+jsp.error.xml.invalidCharInContent = Un car\u00E1cter XML incorrecto (Unicode:
0x[{0}]) se hall\u00F3 en el contenido del elemento del documento.
jsp.error.xml.spaceRequiredBeforeStandalone = Se necesita un espacio en blanco
antes del pseudo-atributo encoding en la declaraci\u00F3n XML.
jsp.error.xml.sdDeclInvalid = El valor de declaraci\u00F3n de documento
standalone debe de ser "yes" o "no", no [{0}].
-jsp.error.xml.invalidCharInPI = Se hall\u00F3 un car\u00E1cter XML incorrecto
(Unicode: 0x{0}) en la instrucci\u00F3n de procesamiento
+jsp.error.xml.invalidCharInPI = Se hall\u00F3 un car\u00E1cter XML incorrecto
(Unicode: 0x[{0}]) en la instrucci\u00F3n de procesamiento
jsp.error.xml.versionNotSupported = No se soporta la versi\u00F3n XML [{0}],
s\u00F3lo se soporta XML 1.0
jsp.error.xml.pseudoAttrNameExpected = se esperaba un pseudo-atributo name.
-jsp.error.xml.expectedByte = Se esperaba byte {0} de {1}-byte de secuencia
UTF-8.
-jsp.error.xml.invalidByte = Incorrecto byte {0} de {1}-byte de secuencia UTF-8.
-jsp.error.xml.operationNotSupported = La operaci\u00F3n [{0}] no est\u00E1
soportada por lector {1}.
-jsp.error.xml.invalidHighSurrogate = Los bits de surrogaci\u00F3n alta en
secuencai UTF-8 no deben de exceder 0x10 pero se hall\u00F3 0x{0}.
+jsp.error.xml.expectedByte = Se esperaba byte [{0}] de [{1}]-byte de secuencia
UTF-8.
+jsp.error.xml.invalidByte = Incorrecto byte [{0}] de [{1}]-byte de secuencia
UTF-8.
+jsp.error.xml.operationNotSupported = La operaci\u00F3n [{0}] no est\u00E1
soportada por lector [{1}].
+jsp.error.xml.invalidHighSurrogate = Los bits de surrogaci\u00F3n alta en
secuencai UTF-8 no deben de exceder 0x10 pero se hall\u00F3 0x[{0}].
jsp.error.xml.invalidASCII = El Byte [{0}] no es ASCII de 7-bit.
jsp.error.xml.spaceRequiredBeforeEncodingInXMLDecl = Se necesita espacio en
blanco antes del pseudo-atributo encoding en la declaraci\u00F3n XML.
jsp.error.xml.spaceRequiredBeforeEncodingInTextDecl = Se necesita espacio en
blanco antes del pseudo-atributo encoding en la declaraci\u00F3n text.
@@ -309,21 +309,21 @@ jsp.error.xml.eqRequiredInXMLDecl = El c
jsp.error.xml.eqRequiredInTextDecl = El car\u00E1cter '' = '' debe de serguir
a [{0}] en la declaraci\u00F3n text.
jsp.error.xml.quoteRequiredInTextDecl = El valor que sigue a [{0}] en la
declaraci\u00F3n text debe de ser una cadena entre comillas.
jsp.error.xml.quoteRequiredInXMLDecl = El valor que sigue a [{0}] en la
declaraci\u00F3n XML debe de ser un cadena entre comillas.
-jsp.error.xml.invalidCharInTextDecl = Un car\u00E1cter XML incorrecto
(Unicode: 0x{0}) se hall\u00F3 en la declaraci\u00F3n text
-jsp.error.xml.invalidCharInXMLDecl = Un car\u00E1cter XML incorrecto (Unicode:
0x{0}) se hall\u00F3 en la declaraci\u00F3n XML
+jsp.error.xml.invalidCharInTextDecl = Un car\u00E1cter XML incorrecto
(Unicode: 0x[{0}]) se hall\u00F3 en la declaraci\u00F3n text
+jsp.error.xml.invalidCharInXMLDecl = Un car\u00E1cter XML incorrecto (Unicode:
0x[{0}]) se hall\u00F3 en la declaraci\u00F3n XML
jsp.error.xml.closeQuoteMissingInTextDecl = Faltan las comillas de cierre en
el valor que sigue a [{0}] en la declaraci\u00F3n text.
jsp.error.xml.closeQuoteMissingInXMLDecl = Faltan las comillas de cierre en el
valor que sigue a [{0}] en la declaraci\u00F3n XML.
jsp.error.multiple.jsp = No puedo tener m\u00FAltiples especificaciones de
-jsp.error.jspoutput.conflict = <jsp:output>: ilegal tener ocurrencias
m\u00FAltiples de [{0}] con diferentes valores (viejo: {1}, nuevo: {2})
+jsp.error.jspoutput.conflict = <jsp:output>: ilegal tener ocurrencias
m\u00FAltiples de [{0}] con diferentes valores (viejo: [{1}], nuevo: [{2}])
jsp.error.jspoutput.doctypenamesystem = <jsp:output>: atributos
'doctype-root-element' y 'doctype-system' deben de aparecer juntos
jsp.error.jspoutput.doctypepulicsystem = <jsp:output>: atributo
'doctype-system' debe de aparecer si aparece atributo 'doctype-public'
jsp.error.jspoutput.nonemptybody = <jsp:output> no debe de tener un
cuerpo
jsp.error.jspoutput.invalidUse = <jsp:output> no se debe de usar en
sint\u00E1xis est\u00E1ndar
-jsp.error.attributes.not.allowed = {0} no debe de tener atributos
-jsp.error.tagfile.badSuffix = Falta sufijo ".tag" en trayectoria de archivo de
tag {0}
-jsp.error.tagfile.illegalPath = Trayectoria de archivo de tag: {0}, debe de
comenzar con "/WEB-INF/tags" o "/META-INF/tags"
-jsp.error.plugin.wrongRootElement = El nombre del elemento ra\u00EDz en {0}
difiere de {1}
-jsp.error.attribute.invalidPrefix = El prefijo de atributo {0} no se
correponde con ninguna biblioteca importada
+jsp.error.attributes.not.allowed = [{0}] no debe de tener atributos
+jsp.error.tagfile.badSuffix = Falta sufijo ".tag" en trayectoria de archivo de
tag [{0}]
+jsp.error.tagfile.illegalPath = Trayectoria de archivo de tag: [{0}], debe de
comenzar con "/WEB-INF/tags" o "/META-INF/tags"
+jsp.error.plugin.wrongRootElement = El nombre del elemento ra\u00EDz en [{0}]
difiere de [{1}]
+jsp.error.attribute.invalidPrefix = El prefijo de atributo [{0}] no se
correponde con ninguna biblioteca importada
jsp.error.nested.jspattribute = Una acci\u00F3n est\u00E1ndar jsp:attribute no
puede estar anidada dentro de otra acci\u00F3n est\u00E1ndar jsp:attribute
jsp.error.nested.jspbody = Una acci\u00F3n est\u00E1ndar jsp:body no puede
estar anidada dentro de otra acci\u00F3n est\u00E1ndar jsp:body o jsp:attribute
jsp.error.variable.either.name = O el atributo name-given o
name-from-attribute deben de ser especificados en una directiva variable
@@ -332,38 +332,38 @@ jsp.error.variable.alias = Ambos atribut
jsp.error.attribute.null_name = Nombre de atributo nulo
jsp.error.jsptext.badcontent = '<', cuando aparece en el cuerpo de
<jsp:text>, debe de estar encapsulado dentro de un CDATA
jsp.error.jsproot.version.invalid = N\u00FAmero incorrecto de versi\u00F3n:
[{0}], debe de ser "1.2" o "2.0" o "2.1" o "2.2" o "2.3"
-jsp.error.noFunction = La funci\u00F3n {0} no puede ser localizada mediante el
prefijo especificado
+jsp.error.noFunction = La funci\u00F3n [{0}] no puede ser localizada mediante
el prefijo especificado
jsp.error.noFunctionMethod = El m\u00E9todo [{0}] para la funci\u00F3n [{1}]
no se pudo hallar en la clase [{2}]
-jsp.error.function.classnotfound = La clase {0} especificada en el TLD para la
funci\u00F3n {1} no se puede hallar: {2}
-jsp.error.signature.classnotfound = La clase {0} especificada en la firma del
m\u00E9todo en el TLD para la funci\u00F3n {1} no se puede hallar. {2}
+jsp.error.function.classnotfound = La clase [{0}] especificada en el TLD para
la funci\u00F3n [{1}] no se puede hallar: [{2}]
+jsp.error.signature.classnotfound = La clase [{0}] especificada en la firma
del m\u00E9todo en el TLD para la funci\u00F3n [{1}] no se puede hallar. [{2}]
jsp.error.text.has_subelement = <jsp:text> no debe de tener subelementos
jsp.error.data.file.read = Error leyendo archivo [{0}]
-jsp.error.prefix.refined = Intento de redefinir el prefijo {0} por {1}, cuando
ya estaba definido como {2} en el \u00E1mbito en curso.
+jsp.error.prefix.refined = Intento de redefinir el prefijo [{0}] por [{1}],
cuando ya estaba definido como [{2}] en el \u00E1mbito en curso.
jsp.error.nested_jsproot = <jsp:root> anidado
jsp.error.unbalanced.endtag = El tgag final "</{0}" est\u00E1 desequilibrado
-jsp.error.invalid.bean = El valor el atributo de clsae useBean {0} es
inv\u00E1lido.
-jsp.error.prefix.use_before_dcl = El prefijo {0} especificado en esta
directiva de marca ha sido usado previamente mediante un fichero de acci\u00F3n
{1} l\u00EDnea {2}.
+jsp.error.invalid.bean = El valor el atributo de clsae useBean [{0}] es
inv\u00E1lido.
+jsp.error.prefix.use_before_dcl = El prefijo [{0}] especificado en esta
directiva de marca ha sido usado previamente mediante un fichero de acci\u00F3n
[{1}] l\u00EDnea [{2}].
jsp.error.lastModified = No puedo determinar la \u00FAltima fecha de
modificaci\u00F3n para el fichero [{0}]
-jsp.exception = Ha sucedido una excepci\u00F3n al procesar la p\u00E1gina JSP
{0} en l\u00EDnea {1}
+jsp.exception = Ha sucedido una excepci\u00F3n al procesar la p\u00E1gina JSP
[{0}] en l\u00EDnea [{1}]
jsp.error.el.template.deferred = #{..} no est\u00E1 permitido en texto de
plantilla
-jsp.error.el.parse = {0} : {1}
+jsp.error.el.parse = [{0}] : [{1}]
jsp.error.page.invalid.deferredsyntaxallowedasliteral = Directiva de
p\u00E1gina: valor inv\u00E1lido para deferredSyntaxAllowedAsLiteral
jsp.error.tag.invalid.deferredsyntaxallowedasliteral = Directiva de marca:
valor inv\u00E1lido para deferredSyntaxAllowedAsLiteral
-jsp.error.page.conflict.deferredsyntaxallowedasliteral = Directiva de
p\u00E1gina: es ilegal tener m\u00FAltiples ocurrencias de
''deferredSyntaxAllowedAsLiteral'' con diferentes valores (viejo: {0}, nuevo:
{1})
-jsp.error.tag.conflict.deferredsyntaxallowedasliteral = Directiva de marca: es
ilegal tener m\u00FAltiples ocurrencias de ''deferredSyntaxAllowedAsLiteral''
con diferentes valores (viejo: {0}, nuevo: {1})
+jsp.error.page.conflict.deferredsyntaxallowedasliteral = Directiva de
p\u00E1gina: es ilegal tener m\u00FAltiples ocurrencias de
''deferredSyntaxAllowedAsLiteral'' con diferentes valores (viejo: [{0}], nuevo:
[{1}])
+jsp.error.tag.conflict.deferredsyntaxallowedasliteral = Directiva de marca: es
ilegal tener m\u00FAltiples ocurrencias de ''deferredSyntaxAllowedAsLiteral''
con diferentes valores (viejo: [{0}], nuevo: [{1}])
jsp.error.page.invalid.trimdirectivewhitespaces = Directiva de p\u00E1gina:
valor inv\u00E1lido para trimDirectiveWhitespaces
jsp.error.tag.invalid.trimdirectivewhitespaces = Directiva de marca: valor
inv\u00E1lido para trimDirectiveWhitespaces
-jsp.error.page.conflict.trimdirectivewhitespaces = Directiva de p\u00E1gina:
es ilegal tener m\u00FAltiples ocurrencias de ''trimDirectivewhitespaces'' con
diferentes valores (viejo: {0}, nuevo: {1})
-jsp.error.tag.conflict.trimdirectivewhitespaces = Directiva de marca: es
ilegal tener m\u00FAltiples ocurrencias de ''trimDirectivewhitespaces'' con
diferentes valores (viejo: {0}, nuevo: {1})
+jsp.error.page.conflict.trimdirectivewhitespaces = Directiva de p\u00E1gina:
es ilegal tener m\u00FAltiples ocurrencias de ''trimDirectivewhitespaces'' con
diferentes valores (viejo: [{0}], nuevo: [{1}])
+jsp.error.tag.conflict.trimdirectivewhitespaces = Directiva de marca: es
ilegal tener m\u00FAltiples ocurrencias de ''trimDirectivewhitespaces'' con
diferentes valores (viejo: [{0}], nuevo: [{1}])
jsp.warning.noJarScanner = Aviso: No se ha puesto org.apache.tomcat.JarScanner
en ServletContext. Volviendo a la implementaci\u00F3n por defecto de JarScanner.
jsp.error.bug48498 = No puedo mostrar extracto de JSP. Probablemente debido a
un error de analizador XML (ver error 48498 de Tomcat para detalles).
jsp.error.duplicateqname = Se ha hallado un atributo con nombre cualificado
duplicado [{0}]. Los nombres de atributos cuallificados deben de se \u00FAnicos
dentro de un elemento.
-jsp.message.jsp_queue_created = Creada cola jsp con tama\u00F1o {0} para el
contexto [{1}]
+jsp.message.jsp_queue_created = Creada cola jsp con tama\u00F1o [{0}] para el
contexto [{1}]
jsp.message.jsp_added = A\u00F1adiendo JSP para ruta [{0}] a cola de contexto
[{1}]
jsp.message.jsp_queue_update = Actuallizando JSP para ruta [{0}] en cola de
contexto [{1}]
jsp.message.jsp_removed_excess = Quitando exceso de JSP para ruta [{0}] desde
cola de contexto [{1}]
-jsp.message.jsp_removed_idle = Quitando JSP ocioso para ruta [{0}] en contexto
[{1}] tras {2} segundos");
-jsp.message.jsp_unload_check = Revisando JSPs para descaga en contexto [{0}],
contador JSP: {1} tamalo de cola: {2}
+jsp.message.jsp_removed_idle = Quitando JSP ocioso para ruta [{0}] en contexto
[{1}] tras [{2}] segundos");
+jsp.message.jsp_unload_check = Revisando JSPs para descaga en contexto [{0}],
contador JSP: [{1}] tamalo de cola: [{2}]
xmlParser.skipBomFail = No pude saltar BOM al analizar flujo de entrada XML
jsp.tldCache.noTldInJar = No se han hallado ficheros TLD en [{0}]. Considera
a\u00F1adir el JAR a la propiedad
tomcat.util.scan.StandardJarScanFilter.jarsToSkip en el fichero
CATALINA_BASE/conf/catalina.propeperties.
jsp.tldCache.noTldSummary = Al menos un JAR, que se ha explorado buscando
TLDs, a\u00FAn no conten\u00EDa TLDs. Activar historial de depuraci\u00F3n para
este historiador para una completa lista de los JARs que fueron explorados y de
los que nos se hall\u00F3 TLDs. Saltarse JARs no necesarios durante la
exploraci\u00F3n puede dar lugar a una mejora de tiempo significativa en el
arranque y compilaci\u00F3n de JSP .
---------------------------------------------------------------------
To unsubscribe, e-mail: dev-unsubscr...@tomcat.apache.org
For additional commands, e-mail: dev-h...@tomcat.apache.org
