Thanks Peter.
Nice detective work. I wonder if anybody in NCBI/RefSeq is reading this? This is
where the source is from...I wonder how blast indexing handles not having a >
for example?
Steve
I have an odd problem. I am trying to search a multi-fasta set of
proteins. If I do:
fuzzpro -sequence invertebrate.protein.faa -pattern CXXXXFYPXXXXXW
-stdout -auto
I get:
Error: Sequence is not a protein
fuzzpro -sequence invertebrate.protein.faa -pattern CXXXXFYPXXXXX
-stdout -auto
returns results.
Any thoughts why? Is this a cryptic way of saying it can't find the
motif or some other problem?
Nothing to do with the pattern. There is a strange sequence there:
>gi|170590912|ref|XP_001900215.1| hypothetical protein Bm1_43765
[Brugia malayi]
MAAQKERLTGDIYJESDIRQKSALSSSATVPSPQMNSQASRSASERQNIWEHRLGIRAPEQNSEQKKYWEYRNIYHIPVP
QGIEFWEDEDKKRWEMINIGGLDESEANRQIKKAKLQLARERQQENRGSRTPQTTHIFFIISLICFGLQIVLAAICIGFC
IYQIFNNSQIEAGIAFLLLALMLLIGAAGGIFSALKRSENLAICTAVYNVTSAVGIIVAIINLYSFRVGQSGNLSAFIPI
AGVVALVQNFNKLS
This sequence has a 'J' which is a mass-spec ambiguity code for "I or L"
and has somehow crept into a translation (perhaps with an ambiguous
codon - there are several possibilties)
EMBOSS 3.0.0 refuses to read it. EMBOSS 4.0.0 also fails.
EMBOSS 5.0.0 and 6.0.0 understand J and should be able to process it and
convert it to X
As for the difference between the patterns - they both fail, but without
the W it gives some results before it reaches the bad sequence.
As you are reporting the results to stdout, it is not so easy to spot ...
but just before the tail of the report I get the "Error: Sequence is not
a protein" line (as one it to stdout and one is to stderr you may not
see it in exactly the same place)
Solutions are: edit the J (and any others) to X in the file
and of course to update your EMBOSS installation to 6.0.0
As to the missing second message about the bad sequence ... if this were
the
only sequence in the file it would issue a message because it can read
nothing. When reading through a file with many sequences it assumes the
first failure is end of file. We need to do something about that - such
as adding the sequence name to the message so you know where it stopped.
Thanks for the report - it was fun to look into.
Peter
_______________________________________________
EMBOSS mailing list
[email protected]
http://lists.open-bio.org/mailman/listinfo/emboss