[android-developers] Benefits of digital marketing for Career and Business

[Priya Gupta]

Digital marketing has completely taken over the traditional marketing 
techniques. It enables the marketer to reach out to a large set of audience 
in a short span of time.As more and more people move on to smartphones, 
tablets and computers, digital marketing has increasingly gained importance.

*Why Digital Marketing is Important*

There are several reasons why the Digital marketing platform has become a 
preferred way of reaching out to customers. Businesses can make the 
information online at a much lower cost than what is required to place an 
advertisement on television or newspaper. This makes it affordable even for 
small business owners. The impact that digital marketing creates on the 
mind of the people while browsing is far more than the traditional ways. 

advertisement can be targeted to a specific set of audience who have a 
greater chance of buying the company’s product. The success of the digital 
marketing campaigns can be easily measured. Valuable data relating to the 
performance can be gathered in real time and analyzed for further decision 
making. One can find out the exact number of people who visit the website. 
Digital analytics also enables marketers to find out the platform that the 
visitors used and for how long they stayed on the website. This is very 
unlike the other mediums like newspaper, where there is no way to find out 
whether the ad generated any sales or not. Because of these reasons, 
companies are increasingly shifting their focus to *digital marketing* 
. They are 
hiring experts in the field who can help them use the digital marketing 
platform to achieve their business goals. The career prospects in this 
industry are therefore very attractive.

-- 
You received this message because you are subscribed to the Google Groups 
"Android Developers" group.
To unsubscribe from this group and stop receiving emails from it, send an email 
to android-developers+unsubscr...@googlegroups.com.
To post to this group, send email to android-developers@googlegroups.com.
Visit this group at https://groups.google.com/group/android-developers.
To view this discussion on the web visit 
https://groups.google.com/d/msgid/android-developers/ce8b65e1-171e-4b5b-9206-2c0d1a286b93%40googlegroups.com.
For more options, visit https://groups.google.com/d/optout.

[android-developers] Immediate role :SCCM Engineer //Long term contract //The Woodlands TX

[Priya Recruiter]

Greetings !!



Hope  you  doing Great !!



This is Priya from  InfoSmart Systems Inc, please let me know if you are
interested and available for the below position. I would appreciate if you
can refer someone for this position.



Title: SCCM Engineer

Location : The Woodlands TX

Duration: Long term contract

Visa : USC,GC and H1b

Experiences : More than 9+Years

*Desired Skills or Experience:*

*Five to 8 year’s systems administration and / or computer engineering
experience.*



*Required Skills:*

Education: *Bachelor degree, with a technical major, such as computer
science or engineering*

Certifications: *Systems Administration/System engineer certification; MCSE
preferred*



   - Interface at Executive level
   - Interface with the business/client- High, Medium, Low
   - Experience working with large teams
   - Experience working independently
   - Experience working with a Global Team





*Technical Skills:*

   - World-class enterprise deployment expert for SCCM
   - Strong relationships into Microsoft including product management team
   - Extensive experience in enterprise troubleshooting





*Infrastructure Skills *

   - Expert knowledge of Microsoft SCCM.
   - Should including design, implementation, and experience
   customizing/extending SCCM/OSD solutions capabilities across large scales
   enterprises
   - Understanding of networking and troubleshooting for SCCM/OSD solutions
   over global networks: WAN/LAN, TCP/IP, DNS, DHCP, Routers, Switches and
   Firewalls
   - Active Directory users and groups, Security permissions and excellent
   understanding of GPOs
   - Server OS skills: Installation, standard usage and troubleshooting of
   Windows Server 2008/2012





*Imaging Skills *

   - Expert level knowledge of current Windows Client based Operating
   Systems (Win 7/10)
   - Excellent understanding of HW/BIOS/Driver/Firmware/OS relationships
   - Excellent understanding of common application installation types (EXE,
   MSI, etc.)
   - Excellent understanding of Microsoft Windows OS imaging & deployment
   tools (Windows PE / WAIK / ADK)
   - Advanced scripting knowledge (VBS/PowerShell/BAT), specifically to
   support AD / WMI queries and batch changes



Thanks & Regards,



[image: infosmart]



Priya
InfoSmart Systems Inc
Direct : (972) 607 3737
Fax : (972) 294 5430
Email : pr...@infosmartsys.com 
www.infosmartsys.com
<http://www.google.com/url?q=http%3A%2F%2Fwww.infosmartsys.com&sa=D&sntz=1&usg=AFQjCNFLE2dPg4-t974v_hoE1b-_aRG3UA>

-- 
You received this message because you are subscribed to the Google Groups 
"Android Developers" group.
To unsubscribe from this group and stop receiving emails from it, send an email 
to android-developers+unsubscr...@googlegroups.com.
To post to this group, send email to android-developers@googlegroups.com.
Visit this group at https://groups.google.com/group/android-developers.
To view this discussion on the web visit 
https://groups.google.com/d/msgid/android-developers/CABm%3DToaELDk9FBTnxQUJ92j9LWssXikz9rtwdvL0Fiit%3D0%3D5ZQ%40mail.gmail.com.
For more options, visit https://groups.google.com/d/optout.

[android-developers] Urgent Role : Scala Developer- 6 months with possible extension - San Francisco, CA

[Priya Recruiter]

Greetings !!




Hope  you  doing Great !!



This is Priya from  *InfoSmart Systems Inc*, please let me know if you are
interested and available for the below position. I would appreciate if you
can refer someone for this position.



*Title: **Scala Developer*

*Location :** San Francisco, CA*

*Duration:* *6 months with possible extension   *

*Visa : USC,GC and H1b *

*Experiences : More than 9+Years*



*MUST to have:*

   - *technologies such as Scala, Spark, Elastic search and HBase*
   - *Java, JBOSS, Spring, Unix shell scripting, Python, hive, Backbone JS
   etc. *
   - *Strong oral and written communication skills *
   - *Ability to work independently *
   - *Ability to work on multiple and often competing issues at the same
   time *





*Thanks & Regards,*



*[image: infosmart]*








*Priya InfoSmart Systems Inc Direct : (972) 607 3737 Fax : (972) 294 5430
Email : pr...@infosmartsys.com 
www.infosmartsys.com
<http://www.google.com/url?q=http%3A%2F%2Fwww.infosmartsys.com&sa=D&sntz=1&usg=AFQjCNFLE2dPg4-t974v_hoE1b-_aRG3UA>
*

-- 
You received this message because you are subscribed to the Google Groups 
"Android Developers" group.
To unsubscribe from this group and stop receiving emails from it, send an email 
to android-developers+unsubscr...@googlegroups.com.
To post to this group, send email to android-developers@googlegroups.com.
Visit this group at https://groups.google.com/group/android-developers.
To view this discussion on the web visit 
https://groups.google.com/d/msgid/android-developers/CABm%3DTobgaKOCZrAd5UU5PPCHR3w3kBdvvg2MJDxBk%3DSTavFVgA%40mail.gmail.com.
For more options, visit https://groups.google.com/d/optout.

[android-developers] Fwd: Requirement for J2EE Application Architect - Dallas, TX

[Priya Recruiter]

*Hello , *



*Greetings from InfoSmart Systems Inc!!!*



We have an immediate requirement with our client and the details are as
follows.



*Role: *J2EE Application Architect

*Location:* Dallas, TX

*Duration: *Long Term

*Required Experience:* 10+ Years





*Description:*
Candidate will be responsible for overall application systems design, and
is knowledgeable in all aspects of designing and constructing J2EE
application systems and developing requirements and design specifications
for new and existing applications. Focuses primarily on documenting
requirements for data, workflow, logical processes, hardware and operating
system environment, including interfaces with other systems. Serves as
architect and leader in the integration of solutions, construction of
applications, development of new business opportunities, and building of
relationships with clients. Must be well versed in various architectural
patterns. Successful candidate will have excellent knowledge of security
(authentication & authorization), integration, performance tuning aspects
of the application/system environment.

*Responsibilities:*

   - Ability to work with business leaders and analysts to understand
   functional and non-functional requirements while crafting a technical
   solution leveraging company and industry best practices and standards
   - Experience in authoring technical architecture documentation utilizing
   the 4+1 Views, design patterns, data models, and conceptual models of the
   proposed solution
   - Serve as the lead architect at the architectural review board seeking
   approval for proposed technical solution
   - Collaborate with the development teams to refine and confirm the
   usefulness of the architecture during construction
   - Improve understanding of the technology landscape and trends
   - Drive the architectural roadmap to leverage upcoming tools, standards,
   and technologies
   - Develop proof-of-concepts and perform research associated with new
   technologies and frameworks
   - Strong technical knowledge, with hands-on experience in systems
   development in a variety of computing architectures and environments
   - Thorough understanding of software development life cycles,
   development and technology tools, testing methodologies, and requirements
   gathering
   - Must have strong technical expertise in the J2EE environment, UNIX,
   Linux, Windows, MQ Series, UML, Tiered architecture, Relational Databases,
   Web development, and object-oriented methodologies
   - Good communication skills, written and verbal
   - Ability to handle multiple projects simultaneously and communicate
   requirements to other companies
   - Proven leadership and relationship management skills
   - B.S. in Computer Science, Engineering, or related discipline, or
   equivalent work experience is required
   - Experience with Agile methodology













*Thanks & Regards,*



*[image: infosmart]*



*Priya*

*InfoSmart Systems IncDirect : (972) 607 3737*


*Fax : (972) 294 5430Email : pr...@infosmartsys.com
www.infosmartsys.com
<http://www.google.com/url?q=http%3A%2F%2Fwww.infosmartsys.com&sa=D&sntz=1&usg=AFQjCNFLE2dPg4-t974v_hoE1b-_aRG3UA>*

-- 
You received this message because you are subscribed to the Google Groups 
"Android Developers" group.
To unsubscribe from this group and stop receiving emails from it, send an email 
to android-developers+unsubscr...@googlegroups.com.
To post to this group, send email to android-developers@googlegroups.com.
Visit this group at https://groups.google.com/group/android-developers.
To view this discussion on the web visit 
https://groups.google.com/d/msgid/android-developers/CABm%3DTobpmLtjbhRWhb%2BTMn82YLYf_zZtqqv88f56AXq9Rxr5YA%40mail.gmail.com.
For more options, visit https://groups.google.com/d/optout.

[android-developers] New Requisition / Project Coordinator / Denver, CO / Long Term Position

[priya . msysinc]

Hi,

 

This is Priya from MSys.

Hope this email finds you well.

 

We have a requirement open for *Project Coordinator*. 

If you have a relevant consultant please send me the updated resume or give 
me a call at *415-202-5274*.

 

*Job Description:*

*Job Title: *Project Coordinator

*Work Location: *Denver, CO
*Duration: *Long Term Position

*Extension Possible: *Yes

*Experience: *4+years

*Mode of Interview: *Telephonic and Skype mandatory

 

*Required Skills:*

   - 4 years experience with project coordinator 
   - Salesforce experience 
   - Perceptive applications experience 

 

*As this is an urgent requirement, I would appreciate if you can call me on 
**415-202-5274* *or respond back with the updated resume and the best 
number to reach you along with answers to following questions. This would 
help us to market your profile with other direct clients.*

 

*Note: Client may ask for background and drug check, If Hired*

 

*Please provide below information in order to submit your profile:*

*Candidate Name*

 

*Present location (city, state or ZIP)*

 

*Work Authorization*

 

*D.O.B. (MM/DD/)*

 

*Last four SSN.*

*Tel No.*

*E-mail ID*

*Skype ID *

 

*Linkedin*

*Onsite availability (post-selection)*

*Total onsite exp, working in US*

 

*Overall relevant exp of candidate*

 

*Notice Period Required*

 

*Degree:  *

 

*University:*

 

*Graduation Year:*

*Interview Availability (Time & Date)*

 

*I look forward to hear from you soon*

 

*Thanks & Regards*

*Priyadarshani S.*

*Technical Recruiter*

*MSys Inc.   *

*Contact: 415-202-5274   *

*Email: priya.msys...@gmail.com*

-- 
You received this message because you are subscribed to the Google Groups 
"Android Developers" group.
To unsubscribe from this group and stop receiving emails from it, send an email 
to android-developers+unsubscr...@googlegroups.com.
To post to this group, send email to android-developers@googlegroups.com.
Visit this group at https://groups.google.com/group/android-developers.
To view this discussion on the web visit 
https://groups.google.com/d/msgid/android-developers/5c109162-f125-4152-b828-87e559918552%40googlegroups.com.
For more options, visit https://groups.google.com/d/optout.

[android-developers] New Requisition / Project Coordinator / Phoenix, AZ / Long Term

[priya . msysinc]

Hi,

 

This is Priya From MSys.

Hope this email finds you well.

 

We have a requirement open for *Project Coordinator*. 

If you have a relevant consultant please send me the updated resume or give 
me a call at *415-202-5274*.

 

*Job Description:*

*Job Title: *Project Coordinator

*Work Location: *Phoenix, AZ

*Extension Possible: *Yes

*Experience: *3+years

*Mode of Interview: *Telephonic and Skype mandatory

 

*Responsibilities*

*The IT Project Coordinator will coordinate activities and resources in 
support of IT portfolios, programs, projects, processes and personnel as 
follows.  *

   - Assist EPMO Manager with tasks to manage and coordinate activities of 
   the EPMO 
   - Coordinate meetings and prepare meeting minutes 
   - Develop documentation and presentation 
   - Perform analysis and develop/present reports and metrics 
   - Develop tracking system for extensive EPMO documentation and organize 
   into electronic folders 
   - Communicate with multiple stakeholders, each with different reporting 
   needs/requirements 
   - Support Project Managers in project management of multiple projects 
   - Develop and maintain Project Schedules 
   - Support Administration of Project/Portfolio Management and Agile Tools 

  

*Project Coordinator Required Skills:*

   - Associates or Bachelor’s Degree or equivalent experience 
   - 3+ years of work experience 
   - Experience as a Project Coordinator, Business Analyst, Executive 
   Assistant or similar position 
   - Strong verbal and written communication and listening skills 
   - Strong follow through, attention to detail and organization skills 
   - Solid time-management and ability to work on multiple tasks 
   simultaneously 
   - Evolving problem-solving skills 
   - Proficient with MS-Office, in particular MS Word and MS Excel 
   - Understands Information Technology Terminology & Processes  
   - Experience with File sharing systems and Internet searching 
   - Ability to work effectively in a matrix managed organization 
   - Personable with customer service skills 

 

*As this is an urgent requirement, I would appreciate if you can call me on 
**415-202-5274* *or respond back with the updated resume and the best 
number to reach you along with answers to following questions. This would 
help us to market your profile with other direct clients.*

 

*Note: Client may ask for background and drug check, If Hired*

 

*Please provide below information in order to submit your profile:*

*Candidate Name*

 

*Present location (city, state or ZIP)*

 

*Work Authorization*

 

*D.O.B. (MM/DD/)*

 

*Last four SSN.*

*Tel No.*

*E-mail ID   *

*Skype ID*

 

*Linkedin*

*Onsite availability (post-selection)*

*Total onsite exp, working in US*

 

*Overall relevant exp of candidate*

 

*Notice Period Required*

 

*Degree:  *

 

*University:*

 

*Graduation Year:   *

*Interview Availability (Time & Date)*

 

*I look forward to hear from you soon*

 

*Thanks & Regards*

*Priyadarshani S.*

*Technical Recruiter*

*MSys Inc.*

*Contact: 415-202-5274   *
*Email: priya.msys...@gmail.com*

-- 
You received this message because you are subscribed to the Google Groups 
"Android Developers" group.
To unsubscribe from this group and stop receiving emails from it, send an email 
to android-developers+unsubscr...@googlegroups.com.
To post to this group, send email to android-developers@googlegroups.com.
Visit this group at https://groups.google.com/group/android-developers.
To view this discussion on the web visit 
https://groups.google.com/d/msgid/android-developers/dae8bfed-130e-4db9-9a35-e15ffe7f7dea%40googlegroups.com.
For more options, visit https://groups.google.com/d/optout.

[android-developers] New Requisition / System/Network Administrator / Columbus, OH / Contract

[priya . msysinc]

Hi,

 

This is Isha Saraf from Virtual Recruiters.

Hope this email finds you well.

 

We have a requirement open for (*System/Network Administrator*). 

If you have a relevant consultant please send me the updated resume or give 
me a call at *415-202-5274*.

 

*Job Description:*

*Job Title: *System/Network Administrator

*Work Location: *Columbus, OH
*Duration: *Contract

*Extension Possible: *Yes

*Experience: *7+years

*Mode of Interview: *Telephonic and Skype mandatory

   

*The responsibilities of this job will include, but are not limited to:*

   - Manage and Monitor all  Servers 
   - Monitor Servers system resource utilization, trending, and capacity 
   planning 
   - Manage and Monitoring Application issues on Servers 
   - SQL Server Management and Monitoring 
   - Web Server and SSL Certs Renewals and working issues 
   - Windows update Management 
   - Provide L1/L2 support in multiple Desktop/Network issue scenarios 
   - Work with OIT Teams on Exchange/McAfee/Networking/FIM/RDirectory/VoIP 
   issues 
   - Active Directory/Group Policy/DNS and DHCP Management 
   - McAfee new products testing and Working with OIT on finding resolution 
   - Work with Application Team on resolving Server/Networking issues 
   - Work with Commerce/DSA staff on improving Networking/Security/QOS 
   standards for Switches/Routers throughout agency(ies) 
   - SCCM related Fixes and updates and finding ways to create new reporting 
   - Create/Manage scripts on Inventory/Management of Enterprise hardware 
   - Deploy and Manage Mobile Devices Enterprise wide and also learn 
   AirWatch deployment for Future deployment in the Agency(ies) 
   - Manage Production/Guest Wireless alongside web filters and Wireless 
   Controller 
   - Work with OIT Teams on Networking hardware related incidents to 
   minimize outage in times of Hardware faults 
   - Work with OIT Engineers on designing Backups specific to Agency(ies) 
   - Manage and Monitor Web, Email and Virus protection 
   - Participate in improving IT procedures to comply with IT security 
   standards 
   - Work with OIT teams on new software/hardware implementations like 
   SolidCore/ISILON/TDP-SQL and new once yet to be implemented. 
   - Provide 24/7 support to Enterprise servers/Networking/Security in case 
   of P1 and P2 incidents 

The ideal candidate will be a part of a team of network engineers ranging 
from 2 – 4 network and security engineers who partner with and collaborate 
with other agencies’ IT teams to solve problems and create technical 
solutions


   
  

*The ideal candidate must have the following skills:*

   - Expert in VMware ESXi and VDI virtualization and troubleshooting 
   - Expert in Routing and switching experience alongside Network firewalls 
   - Expert in Windows Server Administration 
   - Server virtualization 
   - PowerShell scripting / Windows batch scripting / Windows scheduled 
   task management 
   - Expert in QoS guidelines and implementation 
   - Expert in Windows automation/Scripting 
   - VoIP / McAfee / O365 Administration 
   - Secure implementation concepts 
   - Troubleshooting complex technical issues between various disciplines 
   including, but not limited to: 

Ø  Routers & Switches

Ø  Firewalls

Ø  VMware

Ø  Windows Server OS optimization and upgrades

Ø  SCCM and SCOM

Ø  Active Directory & SSO concepts

Ø  IIS / Websphere

Ø  SIEM Event Collectors & Vulnerability Management platforms

Ø  DNS / DHCP / Active Directory and Network communication basics

Ø  Database drivers & connectivity

Ø  Certificate services

Ø  Firewall Administration and troubleshooting

Ø  F5 Load balancers

Ø  Mobile Device Management (Airwatch/Apple DEP)



*As this is an urgent requirement, I would appreciate if you can call me on 
**415-202-5274* *or respond back with the updated resume and the best 
number to reach you along with answers to following questions. This would 
help us to market your profile with other direct clients.*



*Note: Client may ask for background and drug check, If Hired*



*Please provide below information in order to submit your profile:*

*Candidate Name*

 

*Present location (city, state or ZIP)*

 

*Work Authorization*

 

*D.O.B. (MM/DD/) *

 

*Last four SSN.*

*Tel No.  *

*E-mail ID*

*Skype ID *

 

*Linkedin *

*Onsite availability (post-selection)*

*Total onsite exp, working in US*

 

*Overall relevant exp of candidate*

 

*Notice Period Required*

 

*Degree:  *

 

*Universi

[android-developers] New Requisition / System/Network Administrator / Columbus, OH / Long Term

[priya . msysinc]

Hi,

 

This is Isha Saraf from Virtual Recruiters.

Hope this email finds you well.

 

We have a requirement open for (*System/Network Administrator*). 

If you have a relevant consultant please send me the updated resume or give 
me a call at *415-202-5274*.

 

*Job Description:*

*Job Title: *System/Network Administrator

*Work Location: *Columbus, OH
*Duration: *Long term

*Extension Possible: *Yes

*Experience: *7+years

*Mode of Interview: *Telephonic and Skype mandatory

 

*The responsibilities of this job will include, but are not limited to:*

   - Manage and Monitor all  Servers 
   - Monitor Servers system resource utilization, trending, and capacity 
   planning 
   - Manage and Monitoring Application issues on Servers 
   - SQL Server Management and Monitoring 
   - Web Server and SSL Certs Renewals and working issues 
   - Windows update Management 
   - Provide L1/L2 support in multiple Desktop/Network issue scenarios 
   - Work with OIT Teams on Exchange/McAfee/Networking/FIM/RDirectory/VoIP 
   issues 
   - Active Directory/Group Policy/DNS and DHCP Management 
   - McAfee new products testing and Working with OIT on finding resolution 
   - Work with Application Team on resolving Server/Networking issues 
   - Work with Commerce/DSA staff on improving Networking/Security/QOS 
   standards for Switches/Routers throughout agency(ies) 
   - SCCM related Fixes and updates and finding ways to create new reporting 
   - Create/Manage scripts on Inventory/Management of Enterprise hardware 
   - Deploy and Manage Mobile Devices Enterprise wide and also learn 
   AirWatch deployment for Future deployment in the Agency(ies) 
   - Manage Production/Guest Wireless alongside web filters and Wireless 
   Controller 
   - Work with OIT Teams on Networking hardware related incidents to 
   minimize outage in times of Hardware faults 
   - Work with OIT Engineers on designing Backups specific to Agency(ies) 
   - Manage and Monitor Web, Email and Virus protection 
   - Participate in improving IT procedures to comply with IT security 
   standards 
   - Work with OIT teams on new software/hardware implementations like 
   SolidCore/ISILON/TDP-SQL and new once yet to be implemented. 
   - Provide 24/7 support to Enterprise servers/Networking/Security in case 
   of P1 and P2 incidents 

The ideal candidate will be a part of a team of network engineers ranging 
from 2 – 4 network and security engineers who partner with and collaborate 
with other agencies’ IT teams to solve problems and create technical 
solutions


   


*The ideal candidate must have the following skills:*

   - Expert in VMware ESXi and VDI virtualization and troubleshooting 
   - Expert in Routing and switching experience alongside Network firewalls 
   - Expert in Windows Server Administration 
   - Server virtualization 
   - PowerShell scripting / Windows batch scripting / Windows scheduled 
   task management 
   - Expert in QoS guidelines and implementation 
   - Expert in Windows automation/Scripting 
   - VoIP / McAfee / O365 Administration 
   - Secure implementation concepts 
   - Troubleshooting complex technical issues between various disciplines 
   including, but not limited to: 

Ø  Routers & Switches

Ø  Firewalls

Ø  VMware

Ø  Windows Server OS optimization and upgrades

Ø  SCCM and SCOM

Ø  Active Directory & SSO concepts

Ø  IIS / Websphere

Ø  SIEM Event Collectors & Vulnerability Management platforms

Ø  DNS / DHCP / Active Directory and Network communication basics

Ø  Database drivers & connectivity

Ø  Certificate services

Ø  Firewall Administration and troubleshooting

Ø  F5 Load balancers

Ø  Mobile Device Management (Airwatch/Apple DEP)



*As this is an urgent requirement, I would appreciate if you can call me on 
**415-202-5274* *or respond back with the updated resume and the best 
number to reach you along with answers to following questions. This would 
help us to market your profile with other direct clients.*



*Note: Client may ask for background and drug check, If Hired*

 

*Please provide below information in order to submit your profile:*

*Candidate Name*

 

*Present location (city, state or ZIP)*

 

*Work Authorization*

 

*D.O.B. (MM/DD/)*

 

*Last four SSN.*

*Tel No.*

*E-mail ID*

*Skype ID*

 

*Linkedin*

*Onsite availability (post-selection)*

*Total onsite exp, working in US*

 

*Overall relevant exp of candidate*

 

*Notice Period Required*

 

*Degree:  *

 

*University:*

 

*Graduation Year:*

*Interview Availability (Time & Date)*

 

*I look forward to hear from you soon*

 

*Thanks & Regards*

*Priyadarshani S.*

*Technical Recruiter*

*MSys Inc.*

*Contact: 415-202-5274   *

[android-developers] RE:: Direct Client :Sr. DevOps Engineer //6+ Months // Frisco, TX

[Priya Recruiter]

Hello,



*Greetings from InfoSmart Systems Inc!!!*



*Thanks for applying through indeed for the below mentioned position.*



*Role: **Sr. DevOps Engineer*

*Location:* Forth Ward,TX

*Duration: *6+ Months

*Start Date:*  ASAP

Visa : USC and GC ,H1b



*Description*

Client is seeking a talented and technical Senior DevOps Engineer who is
capable of leading process and tool set implementation and improvement that
will enable Continuous Integration/Deployment environments and workflows.
The Senior DevOps Engineer must be innovative, energetic, and driven to
provide supper customer experiences.

You will leverage your combination of consulting skills, technical ability,
development knowledge, and architecture strategy to assess the needs of a
customer to leverage DevOps methodologies. This role requires coordination
with internal customers in a DevOPs fashion with Developers, QA, Operations
and Release Managers as well as leaders across the enterprise.

The ideal candidate would have experience spanning multiple IT disciplines,
including application development, Infrastructure engineering and
operations (monitoring, configuration and management, system
administration, database administration)

*Responsibilities*

·   Establish enterprise-grade continuous integration and continuous
delivery (CI/CD) toolchain service including GitHub Enterprise, Cloudbees
Jenkins, SonaType Nexus Repository Manager.

·   Integrate upstream and downstream development/QA/Security testing
tools in to the enterprise  toolchain

·   Upgrade, maintain, and improve the DevOps toolchain service
infrastructure.

·   Automate application build and deployment pipeline utilizing the
DevOps toolchain

·   Support traditional release management model while adopting DevOps
release principles and best practice

·   Responsible for services availability, integrity and stability

*Required Qualifications *

·   Bachelor's degree in computer science, or other related technical
field

·   2 or more years of experience working in Agile software development
or related field using Java, or .NET.

·   Minimum of 5 years of experience with installation, configuration
and administration of continuous integration tool Jenkins. Must have
working experience with Jenkins Pipeline job and Groovy scripts.
Experience with CloudBees Enterprise Jenkins is preferred.

·   Minimum of 2 years of experience with source code management system
configuration and administration, such as Git, SVN, AccuRev. GitHub
Enterprise is preferred.

·   Ability to integrate Quality testing and Security testing tools
into CI process (e.g., HP QTP, Selenium, JMeter, HP Fortify, SonarQube)

·   Experience with build tools Ant and Maven is desired

·   Systems Administration experience in Linux and/or Unix environment
with Shell, Python, Ruby.

·   Working knowledge of common networking protocols (e.g., HTTP, TCP,
IP, SSH, FTP, SMTP, DNS, LDAP), load balancer, firewall, storage.

·   Capable of writing comprehensive technical documentation and
diagrams

·   Can communicate technology effectively with different level of
audience.



*You'll stand out from the crowd with:*

·   Understanding of service-oriented architecture (REST APIs,
micro-services, etc.) and ability to develop code to make API calls

·   Large scale application deployment experience. Extensive build and
release engineering experience and proven ability to design and develop
automated deployment solutions.

·   Knowledge of Cloud-native platform such as Cloud Foundry

·   Experience with creating infrastructure as code (Docker, Puppet,
chef etc.)













*Thanks & Regards,*



*[image: infosmart]*





*PriyaInfoSmart Systems IncDirect : (972) 607 3737*


*Fax : (972) 294 5430Email : pr...@infosmartsys.com
www.infosmartsys.com
*

-- 
You received this message because you are subscribed to the Google Groups 
"Android Developers" group.
To unsubscribe from this group and stop receiving emails from it, send an email 
to android-developers+unsubscr...@googlegroups.com.
To post to this group, send email to android-developers@googlegroups.com.
Visit this group at https://groups.google.com/group/android-developers.
To view this discussion on the web visit 
https://groups.google.com/d/msgid/android-developers/CABm%3DToZEiLEJR%3DDozfj7AOWkRiHmp%2BLFWbUGs5pFG0AV9oO6gg%40mail.gmail.com.
For more options, visit https://groups.google.com/d/optout.

[android-developers] RE :Direct Client Requirement :Hadoop Architect - Newark, NJ - C2H

[Priya Recruiter]

*Hello ,*



*Greetings from InfoSmart Systems Inc!!!*



We have an immediate requirement with our client and the details are as
follows.



*Role: Hadoop Architect *

*Location:* Newark, NJ

*Duration: *C2H

*Start Date:*  ASAP



*Position Overview *

Client is looking for Sr Hadoop Architect whose primary responsibility will
be designing and developing new applications. The candidate will be part of
a team that works with Business Analysts, Investment Professionals,
Operations, Quality Assurance Testers and other System Professionals.


*Responsibilities*

   - Analyze business requirements then design & develop applications to
   support them, suggesting the innovative use of newer technologies where
   appropriate.
   - Understand & follow the complete agile SDLC methodology.
   - Build and maintain positive relationships with internal clients & IT
   co-workers.
   - Possess excellent oral and written communication skills.
   - Have the ability to manage multiple tasks and projects simultaneously.
   - Possess the ability to associate past experience with current events
   in order to resolve problems or generate new ideas.
   - Develop & execute test scenarios ensuring the stability/performance of
   applications.



*Qualifications *

   - Bachelor's degree in Computer Science, Engineering, or equivalent work
   experience.
   - Minimum of 7+ years of experience working with Java, Linux/Unix, Shell
   Scripting, and RDBMS.
   - Minimum of 3 years solid experience w/Hadoop & related Stack.
   - Must have working knowledge of MapReduce, Pig and Hive
   - Knowledge of Impala is highly recommended.
   - Cloudera certification added advantage.
   - Prior experience with Pentaho Data Integration (PDI) is desirable.
   - Experience with architecture, design & development of Big Data & Data
   Marts utilizing Hadoop and/or in-memory databases such as MongoDB, HBase
   - Knowledge of Jira, Confluence, Agile development methodology & DevOps
   is a +.
   - Desire to learn the Fixed Income Business









*Thanks & Regards,*





*Priya InfoSmart Systems Inc Direct : (972) 607 3737*


* Fax : (972) 294 5430 Email : pr...@infosmartsys.com
 www.infosmartsys.com
<http://www.google.com/url?q=http%3A%2F%2Fwww.infosmartsys.com&sa=D&sntz=1&usg=AFQjCNFLE2dPg4-t974v_hoE1b-_aRG3UA>*

-- 
You received this message because you are subscribed to the Google Groups 
"Android Developers" group.
To unsubscribe from this group and stop receiving emails from it, send an email 
to android-developers+unsubscr...@googlegroups.com.
To post to this group, send email to android-developers@googlegroups.com.
Visit this group at https://groups.google.com/group/android-developers.
To view this discussion on the web visit 
https://groups.google.com/d/msgid/android-developers/CABm%3DToYPh3dc7QAnHsGuwZJJZhn_LwBphK2mV%3DEg3Ahr74NjaA%40mail.gmail.com.
For more options, visit https://groups.google.com/d/optout.

[android-developers] Direct Client requirement: Unix/Linux Operations Analyst -10 Months - Houston,TX

[Priya Recruiter]

Hi ,



Hope  you  doing Great !!



This is Priya from  *InfoSmart Systems Inc*, please let me know if you are
interested and available for the below position. I would appreciate if you
can refer someone for this position.




* Job Description:*Unix/Linux Operations Analyst

Location: Houston,TX

Duration:10 months

 Exp: 10+  years


*Job Summary:*

Provide support for Unix/Linux Servers (installation, configuration,
upgrade, documentation, maintenance, retirement, problem resolution,
disaster recovery, etc.)  Maintain base infrastructure software for
approximately 2000 servers.



*Description:*

Work group provides L2 support for multiple Unix/Linux server and client
platforms globally; requires multiple interactions with various support
organizations (external vendors, applications, database administrators,
enterprise storage and projects).   Effectively work with other operations
and infrastructure groups, applications, business IT representatives and
support vendors to provide secure, highly reliable and available Unix/Linux
systems.



*Job Requirements:*

•  B.S. in Computer Science or equivalent skills work
experience

•  Job will require candidates with excellent
technical, analytical & communication skills.

•  Requires at least 3 years of working knowledge of
Unix/Linux (Linux, Solaris, HP-UX, AIX) servers, and their integration to
infrastructure components (networking, storage, backups, monitoring) and
working knowledge of the operating environments and operational processes
(i.e. problem/change management, operational reliability, security,
operations acceptance).

•  Provide high end technical support for Unix/Linux
Servers (installation, configuration, maintenance, upgrade, retirement,
problem resolution, disaster recovery, etc.)

•  Proficiency in technical writing and documentation
of solutions

•  Expertise in the installation, use, and maintenance
of Red Hat Satellite, Puppet Enterprise, remote terminal emulation systems,
and Centrify.

•  Knowledge of Red Hat CloudForms, application
containerization, virtualization, and hyper-converged infrastructure.

*Other activities include:*

•  Scripting solutions to achieve problem resolution
and seamless rollouts (Perl, Puppet – Ruby – bash scripting, C/C++)

•  Provide input to service strategies supported by
Unix/Linux and Linux teams

•  Provide input to Asset Management groups for
software / hardware renewals

•  Review projects for infrastructure impacts and
adherence to approved engineering design guidelines

•  Assist/Consult with applications regarding end of
life assessments, and capacity upgrades



*Skill Requirements:*

•  High Level of skill and experience with Unix/Linux
in a large data center working with infrastructure and applications.

•  Strong IT skills in Infrastructure and Applications.

•  Infrastructure engineering and operational support
experience.

•  Experience in multiple mission critical, disaster
recovery technologies and service lines.

Experience in implementing change and security controls in a global
framework



.*Priya*


* InfoSmart Systems Inc Direct : (972) 607 3737*


* Fax : (972) 294 5430 Email : pr...@infosmartsys.com
 www.infosmartsys.com
<http://www.google.com/url?q=http%3A%2F%2Fwww.infosmartsys.com&sa=D&sntz=1&usg=AFQjCNFLE2dPg4-t974v_hoE1b-_aRG3UA>*

-- 
You received this message because you are subscribed to the Google Groups 
"Android Developers" group.
To unsubscribe from this group and stop receiving emails from it, send an email 
to android-developers+unsubscr...@googlegroups.com.
To post to this group, send email to android-developers@googlegroups.com.
Visit this group at https://groups.google.com/group/android-developers.
To view this discussion on the web visit 
https://groups.google.com/d/msgid/android-developers/CABm%3DTobGp%3D729nV9a2mpiBjy81E823_wpCSrs_oyqiKyCyhyUg%40mail.gmail.com.
For more options, visit https://groups.google.com/d/optout.

[android-developers] Direct Client Requirement::SAP SD SOLUTION Architect - 6 Months - Greenville, SC

[Priya Recruiter]

Greetings !!



Hope  you  doing Great !!



This is Priya from  *Info Smart Systems Inc*, please let me know if you are
interested and available for the below position. I would appreciate if you
can refer someone for this position.



*Title*: *SAP SD SOLUTION Architect*

*Location*: Greenville, SC

*Duration**:*6 Months



*Mandatory : Need Only **Architect Levels.*



*Job Description: *

   - 10+yrs Years of SAP Sales and Distribution



   - Minimum of 3 full SAP E2E implementation experience



   - 3-5 years of Onsite Lead/Architect experience as Single Point of
   Contact for functional and business process decisions



   - Configure / customize SD business process requirements in SAP system



   - Experience in providing functional specifications for technical
   requirements (Reports, Interfaces, Enhancements, Forms)



   - Good knowledge on integration to other modules FI, CO, SD, PP, QM



   - Demonstrate a commitment to customer service, anticipate, meet and
   exceed expectations by solving problems quickly and effectively; making
   customer issues a priority



   - Ability to write highly detailed functional specifications for
   outputs, interfaces and custom functionalities



   - Good analytical, communication skills, documentation skills, open
   communicator, with a strong customer focus, etc.





*Thanks & Regards,*



*[image: infosmart]*








*Priya InfoSmart Systems Inc Direct : (972) 607 3737 Fax : (972) 294 5430
Email : pr...@infosmartsys.com 
www.infosmartsys.com
<http://www.google.com/url?q=http%3A%2F%2Fwww.infosmartsys.com&sa=D&sntz=1&usg=AFQjCNFLE2dPg4-t974v_hoE1b-_aRG3UA>
*

-- 
You received this message because you are subscribed to the Google Groups 
"Android Developers" group.
To unsubscribe from this group and stop receiving emails from it, send an email 
to android-developers+unsubscr...@googlegroups.com.
To post to this group, send email to android-developers@googlegroups.com.
Visit this group at https://groups.google.com/group/android-developers.
To view this discussion on the web visit 
https://groups.google.com/d/msgid/android-developers/CABm%3DToYmOV5r95KagvgiUakLXzA_k568iWkJeu4E7eBp1j1PdQ%40mail.gmail.com.
For more options, visit https://groups.google.com/d/optout.

[android-developers] Required:::Big Data Architect at San Jose, CA

[Priya S]

Hi,

Hope you are doing Good!



This is Priya Technical Recruiter form Virtual Recruiters Pvt Ltd. We have
come across your profile on LinkedIn/Job Boards and we found your profile
matching to the below job description.



*Title: Big Data Architect*



*Location: San Jose, CA*



*Duration: Long term*



   -

   Strong experience in Big data, Analytics, Hadoop, Modelling experience
   is key (especially Structured Modelling in Hadoop).
   -

   Overall exp should be 7+ years.
   -

   The person need to know Hadoop in and out, Hive and HSQL.
   -

   Modeling of structure data on top of the unstructured data platform.
   Scale the data, data integrations via Talend or other ETLs and ability to
   come up with key metrics definitions etc.
   -

   Need to be very very hands on engineer.



 Thanks & Regards,

*Priyadarshani S.*
Technical Recruiter

Virtual Recruiters Pvt Ltd.

201.266.0710

*priyadarsh...@virtualrecruiters.co *

-- 
You received this message because you are subscribed to the Google Groups 
"Android Developers" group.
To unsubscribe from this group and stop receiving emails from it, send an email 
to android-developers+unsubscr...@googlegroups.com.
To post to this group, send email to android-developers@googlegroups.com.
Visit this group at https://groups.google.com/group/android-developers.
To view this discussion on the web visit 
https://groups.google.com/d/msgid/android-developers/CABeo%2BGOymhR4Jn0oSPrRWLBWm8XZPVG2H-PiiwOLrikvFse6bQ%40mail.gmail.com.
For more options, visit https://groups.google.com/d/optout.

[android-developers] Required:::IT Analyst at San Jose, CA

[Priya S]

Hi,



Hope you are doing Good!



This is Priya Technical Recruiter form Virtual Recruiters Pvt Ltd. We have
come across your profile on LinkedIn/Job Boards and we found your profile
matching to the below job description.



*Title: IT Analyst*

*Location: San Jose, CA*



*Duration: Long term*



*Primary Responsibilities*



   -

   Able to guide the team through the development, testing and
   implementation stages and review the completed work effectively
   -

   Provide direction and technical expertise in design, development and
   systems integration
   -

   Able to make quick decisions and solve technical problems to provide an
   efficient environment for project implementation
   -

   Ensure standard operating procedures and project guidelines are in place
   -

   Project scheduling and resource management
   -

   Planning, budgeting and reporting on projects
   -

   Make presentations on project status, present monthly and annual reports
   to senior management
   -

   Meet with client teams and gather requirements, conduct regular team
   meetings and track project progress
   -

   Must ensure teams follow the correct procedures, policies and
   documentation requirements across project phases


Thanks & Regards,

*Priyadarshani S.*
Technical Recruiter

Virtual Recruiters Pvt Ltd.

201.266.0710

*priyadarsh...@virtualrecruiters.co *

-- 
You received this message because you are subscribed to the Google Groups 
"Android Developers" group.
To unsubscribe from this group and stop receiving emails from it, send an email 
to android-developers+unsubscr...@googlegroups.com.
To post to this group, send email to android-developers@googlegroups.com.
Visit this group at https://groups.google.com/group/android-developers.
To view this discussion on the web visit 
https://groups.google.com/d/msgid/android-developers/CABeo%2BGPtO3cnKp5juGKGQHDJvDhen008kN%3Dh2ByaqnQVkDYvbg%40mail.gmail.com.
For more options, visit https://groups.google.com/d/optout.

[android-developers] Required::::Sr. Software Engineer at Livonia, MI

[Priya S]

Hi,



Hope you are doing Good!



This is Priya Technical Recruiter form Virtual Recruiters Pvt Ltd. We have
come across your profile on LinkedIn/Job Boards and we found your profile
matching to the below job description.



*Title: Sr. Software Engineer*



*Location: Livonia, MI*



*Duration: Long term*



Primary Responsibilities



   -

   SME in Software development processes and tools (including open source)
   -

   Own the current S/W Architecture and IT toolset to support software
   development and enhance it per business requirements.
   -

   Work with business to assess current software development problems and
   issues, define desired future states, define solution architecture and make
   solutions recommendations and guide the implementation.
   -

   Recommends and implements corrections in highly complex technical
   applications and analysis to enhance performance.
   -

   Set up projects in CLM that use different development methodologies like
   Agile, Iterative or Waterfall.
   -

   Configure the s/w development tools for generating ad hoc and standard
   reports.
   -

   Integrate RTC with other toolsets.
   -

   Create physical and logical architecture solution roadmaps for linking
   services solutions with client business processes and technologies.
   -

   Guide the IT Application support team in the area of software
   development.
   -

   Provides the customer base with second level support.
   -

   Document RTC administration, configuration and training materials.
   -

   Work with project management to communicate status, risks, and issues.


Thanks & Regards,

*Priyadarshani S.*
Technical Recruiter

Virtual Recruiters Pvt Ltd.

201.266.0710

*priyadarsh...@virtualrecruiters.co *

-- 
You received this message because you are subscribed to the Google Groups 
"Android Developers" group.
To unsubscribe from this group and stop receiving emails from it, send an email 
to android-developers+unsubscr...@googlegroups.com.
To post to this group, send email to android-developers@googlegroups.com.
Visit this group at https://groups.google.com/group/android-developers.
To view this discussion on the web visit 
https://groups.google.com/d/msgid/android-developers/CABeo%2BGO1GbXR5jRPiPjb%2B52B0w4f%3D%3DmyK%2B2tRfaxKO%3DB7TYKrw%40mail.gmail.com.
For more options, visit https://groups.google.com/d/optout.

[android-developers] Required::::GIS Data Editor at Fort Worth, TX

[Priya S]

Hi,

Hope you are doing Good!

This is Priya Technical Recruiter form Virtual Recruiters Pvt Ltd. We have
come across your profile on LinkedIn/Job Boards and we found your profile
matching to the below job description.





*Position:  GIS Data EditorLocation: Fort Worth, TXDuration: 6 Months to 12
Months*

Job Description:

•  5 years ArcGIS desktop experience in data editing with change
management at the core of every function.

•  Must have a strong working knowledge of ArcMap 10.X editing,
versioning, validation, and analysis tools.

•  Must have working knowledge of ESRI Products. Familiarity of
Linear Referencing systems is desired. Experience in LiDAR Point Cloud
Extraction workflows is a plus.

•  Previous transportation (railroad preferred) experience is a
plus. Qualified applicants must demonstrate above average organizational
skills and a desire to drive for results.

•  Must be self-directed, motivated and have good interpersonal and
communication skills. Must be willing to learn safe railroad operations and
practices.

•  Must have ability to communicate well, one-on-one and in groups.
Must be safety conscious and able to support and contribute to a strong
safety process.

Thanks & Regards,

*Priyadarshani S.*
Technical Recruiter

Virtual Recruiters Pvt Ltd.

201.266.0710

​*priyadarsh...@virtualrecruiters.co *

-- 
You received this message because you are subscribed to the Google Groups 
"Android Developers" group.
To unsubscribe from this group and stop receiving emails from it, send an email 
to android-developers+unsubscr...@googlegroups.com.
To post to this group, send email to android-developers@googlegroups.com.
Visit this group at https://groups.google.com/group/android-developers.
To view this discussion on the web visit 
https://groups.google.com/d/msgid/android-developers/CABeo%2BGNBpfmScyLokrT6X1hvoyM6WzSQV0_mSfNejgZ64t6G9A%40mail.gmail.com.
For more options, visit https://groups.google.com/d/optout.

[android-developers] Hi, Hope you are doing Good! This is Priya Technical Recruiter form Virtual Recruiters Pvt Ltd. We have come across your profile on LinkedIn/Job Boards and we found your profile m

[Priya S]

Hi,


Hope you are doing Good!

This is Priya Technical Recruiter form Virtual Recruiters Pvt Ltd. We have
come across your profile on LinkedIn/Job Boards and we found your profile
matching to the below job description.


*Position:  GRID-AC/CDF with Cassandra experience*

*Location: Richardson, TX OR Alpharetta, GA*

*Duration: 6 Months to 12 Months*


*Job Description:*

*Hands on experience in Apache Cassandra is must. Please do not share
profiles without Cassandra experience.*

· Resource who has worked on middleware application and excellent JAVA
developer.

· Quick learner and should have good exposure to direct client facing work
culture.

· 5+ Years’ Experience designing, developing , deploying & Supporting large
scale distributed systems and API development.

· 5+ Years’ experience MUST in Core Java, Web services, JMS technologies.

· 3+ Years’ of Data Serialization format (POF, Thrift, JSON, XML etc).

· Hands on experience in basic Unix Shell scripting.

· Should have worked in maven based projects.



*Preferred Skills:*
Hands on experience in Hazel cast:

· Hands on experience in NIFI.

· Knowledge of Zookeeper or scampler Tool.

· Hands on experience in Solace queues or apache kafka.

Thanks & Regards,

*Priyadarshani S.*
Technical Recruiter

Virtual Recruiters Pvt Ltd.

201.266.0710

​*priyadarsh...@virtualrecruiters.co *

-- 
You received this message because you are subscribed to the Google Groups 
"Android Developers" group.
To unsubscribe from this group and stop receiving emails from it, send an email 
to android-developers+unsubscr...@googlegroups.com.
To post to this group, send email to android-developers@googlegroups.com.
Visit this group at https://groups.google.com/group/android-developers.
To view this discussion on the web visit 
https://groups.google.com/d/msgid/android-developers/CABeo%2BGOjgfbxXONZg%3DDhM_1biA7SXd%2Boupy-3GJXZNHTq57nuw%40mail.gmail.com.
For more options, visit https://groups.google.com/d/optout.

[android-developers] Required:::Sr. Software Engineer at ATLANTA, GA

[Priya S]

Hi,

Hope you are doing Good!

This is Priya Technical Recruiter form Virtual Recruiters Pvt Ltd. We have
come across your profile on LinkedIn/Job Boards and we found your profile
matching to the below job description.

*Position:  Sr. Software Engineer*

*Location: ATLANTA, GA*

*Duration: 6 Months to 12 Months*

· Strong working knowledge of Meridium tools.

· 5+ yrs Experience on MS .Net & SQL Database.

· Experience in MuleSoft, Talend integration tool   expected to perform
following activities.

· Integrate the data from ERP systems (like SAP, Oracle Apps) into APM.

· Integrate the data from PCI.

· Integrate the data from CMMS.


Thanks & Regards,

*Priyadarshani S.*
Technical Recruiter

Virtual Recruiters Pvt Ltd.

201.266.0710

​*priyadarsh...@virtualrecruiters.co *

-- 
You received this message because you are subscribed to the Google Groups 
"Android Developers" group.
To unsubscribe from this group and stop receiving emails from it, send an email 
to android-developers+unsubscr...@googlegroups.com.
To post to this group, send email to android-developers@googlegroups.com.
Visit this group at https://groups.google.com/group/android-developers.
To view this discussion on the web visit 
https://groups.google.com/d/msgid/android-developers/CABeo%2BGM0Q2p7%2BAtdSLAnWZ0Cn8j6TDRovcou8LPb2Geywa3%2Bdg%40mail.gmail.com.
For more options, visit https://groups.google.com/d/optout.

[android-developers] Required:::CQ5 AEM at Dallas, TX

[Priya S]

Hi,

Hope you are doing Good!


This is Priya Technical Recruiter form Virtual Recruiters Pvt Ltd. We have
come across your profile on LinkedIn/Job Boards and we found your profile
matching to the below job description.


*Position:  CQ5 AEM*

*Location: Dallas, TX*

*Duration: 6 Months to 12 Months*


*Job Description:*

   -

   6+ Years of experience in Content Managment or Java/J2EE
   -

   3+ years of experience in AEM
   -

   Experience delivering Adobe AEM projects and a recognized expert (by
   clients, partners and colleagues) in AEM
   -

   Proactively maintain the highest level of technical expertise by staying
   current on Adobe AEM technologies


Thanks & Regards,

*Priyadarshani S.*
Technical Recruiter

Virtual Recruiters Pvt Ltd.

201.266.0710

​*priyadarsh...@virtualrecruiters.co *

-- 
You received this message because you are subscribed to the Google Groups 
"Android Developers" group.
To unsubscribe from this group and stop receiving emails from it, send an email 
to android-developers+unsubscr...@googlegroups.com.
To post to this group, send email to android-developers@googlegroups.com.
Visit this group at https://groups.google.com/group/android-developers.
To view this discussion on the web visit 
https://groups.google.com/d/msgid/android-developers/CABeo%2BGP%3DZ7%2Ba2RBm6ihE4i_Ex36%2Bavw6v6nWowkjK60XKwprcA%40mail.gmail.com.
For more options, visit https://groups.google.com/d/optout.

[android-developers] Required:::Web Designer - F2F Interview at Phoenix, AZ

[Priya S]

Hi,​

Hope you are doing Good!

This is Priya Technical Recruiter form MSYS, Inc. We have come across your
profile on LinkedIn/Job Boards and we found your profile matching to the
below job description.

*Position:  Web Designer - F2F Interview*

*Location: Phoenix, AZ*

*Duration: Long term*

*Description:*

*** F2F Interview required ***

Required Skills

· Have extensive experience with HTML5, CSS3, JavaScript and jQuery

· Have solid PHP experience;

· strong graphic design background

· Have implemented Bootstrap and/or Foundation front-end responsive
CSS frameworks;

· Are familiar with Adobe Creative Suite;

· Are familiar with Agile project development methods;

· Have experience with GIT version control;

· Drupal 7 and WordPress experience is a major plus;

· Are OK with having to complete a high volume of website
maintenance jobs that may not be technically challenging, but must be done
very accurately;

· Design clean, clean, clean user interface mockups and turn them
into functional websites;

· Understand user center design and responsive design techniques,
and have the online portfolio to back it up;

· Integrate SEO into absolutely everything you do;

· Have plenty of real-world design and responsive development
experience (no school project portfolio pieces laying around);

· Never let anything leave your hands before it’s been
cross-browser and device tested;

· Participate in online team collaboration tools with the type of
efficiency that makes others want to go back and modify their entries;

· Know what it means to be a strong communicator and model it;

· Have a degree in computer science, design or related and a ton of
hands-on experience in the public or private sector;

· Have an easy-going personality and love team interaction;

Thank you!!

Priya S.

Technical Recruiter

MSys Inc.,

140 Iowa Lane #201 Cary NC 27511

Direct (972) 544 7798

pr...@msysinc.com 

www.msysinc.com

-- 
You received this message because you are subscribed to the Google Groups 
"Android Developers" group.
To unsubscribe from this group and stop receiving emails from it, send an email 
to android-developers+unsubscr...@googlegroups.com.
To post to this group, send email to android-developers@googlegroups.com.
Visit this group at https://groups.google.com/group/android-developers.
To view this discussion on the web visit 
https://groups.google.com/d/msgid/android-developers/CABeo%2BGObzU3SzSx%3DX31eBBvbm3rmKRb_UGsMJm%3D-8fs-%2Bb5iwQ%40mail.gmail.com.
For more options, visit https://groups.google.com/d/optout.

[android-developers] Re: Exclusive Requirement-- Scrum Master (SM)(Local or Nearby)

[shanthi priya ramamoorthy]

Hi,
 
Please find the enclosed resume of our consultant and let me know you’re 
interest level. Consultant is open for relocation and available immediately.
 
BA/scrum master Consultant contact details are enclosed in resume.


Thanks,
Shanthi Priya, 
Bench sales recuriter,
Xtramiletechnologies LLC
Mobile: (307) 222-3143
Xtramiletechnologies | New Jersey
Email: pr...@xtramiletechnologies.com
URL: http://xtramiletechnologies.com


On Tuesday, August 23, 2016 at 12:35:54 AM UTC+5:30, Bharat Chhibber wrote:
>
> Hello,
>
> Hope you are doing well
>
> This is Bharat from Niyo Infotech.. Please find the JD below and if you 
> have any consultant available then please let me know ASAP at 
> bhar...@nityo.com .
>
>  
>
>  
>
> *Role: Scrum Master (SM)* 
>
> *Location: **Willmington ,DE*
>
> *Long Term*
>
>
> *Responsibilities:* 
>
> •Mentors the empowered, self-organizing, and self-accountable 
> teams that are responsible for delivery of successful outcomes at each 
> sprint. 
> •Facilitates the teams progress toward the PSI and team objectives
>  
> •Protects the team from external distractions 
> •Leads the team’s efforts in continuous improvement which 
> includes; helping the team to improve, take responsibility for their 
> actions and become problem solvers for themselves. 
> •Records suggested improvements and tracks progress towards 
> achieving these goals 
> •Enforces the rules of the SAFe Agile and Development Team Scrum 
> process 
> •Helps eliminate obstacles to the adoption of enterprise Technical 
> Practices - adhering to SAFe’s - Six Agile Software Engineering Practices 
> for Achieving High Quality Code – agile architecture, continuous 
> integration, test-first, refactoring, pair work and collective ownership 
> •Leads the team to stay focused on Business and Sprint Goals 
> •Identifies and tracks cross-team dependencies 
> •Eliminates impediments by actively addressing issues with other 
> scrum teams so that the team can stay focused on achieving the objectives 
> of the iteration. 
> •Coordinates with other Scrum Masters, the Systems Team and shared 
> resources in the Agile Release Train (ART) Release Planning meetings. 
> •Facilitates preparation and readiness for Sprint and PSI Planning 
> meetings 
> •Works with other Scrum Masters, the Systems Team and shared 
> resources throughout each Sprint and PSI 
> •Uses normalized estimating to help the program estimate larger 
> features and EPICs 
> •Assists the Product Owner in preparing for various 
> planning,backlog refinement meetings and other requested activities 
> •Keeps track of the backlog to assist the Product Owner in 
> aligning User Stories with Features / Business Objectives 
> •Documents decisions as needed 
> •Coordinates teams operating under architectural and portfolio 
> governance, system level integration and System Demos 
> •Participates in the Scrum of Scrums and coordinates with other 
> Scrum Masters as necessary 
> •Escalates impediments and risks to the RTE that cannot be 
> resolved at the team level 
> •Facilitates team collaboration with  System Architect  to ensure 
> high quality technical delivery 
> •Facilitates team collaboration with QA Manager to drive testing 
> strategies, testing automation and overall quality process improvement 
> •Supports RET and Scrum Master in Train/Team retrospectives and 
> continuous improvement activities. 
> •Support User Acceptance Testing Process 
> •Works with Product Management and Product Ownerto help assure 
> strategy and execution alignment 
> •Encourages Communities of Practice around SAFeby participating in 
> the Scrum Master Community of Practice forums 
> •Acts as a mindset change agent from traditional team manager to 
> servant leader 
>
> This position reports to the Development Delivery Manager of the Agile 
> Release Train 
>
> •Displays Servant Leadership skills 
> •Working knowledge of Scrum, XP, and SAFe(CSM preferred) 
> •Ability to motivate a team 
> •Proven decision-making, problem-solving and conflict resolution 
> skills. 
> •Detail oriented with the ability to organize and prioritize tasks 
> to ensure timely delivery of the Sprints/PSI’s. 
> •Strong Process orientation 
> •Strong conceptual grasp of technology with successful history of 
> delivery technical projects. 
> •Strong understanding of SAFe or iterative development processes, 
> quality and testing best practices. 
> •Extens

[android-developers] Re: Urgent Need---Scrum Master-----EAD or GC or Citizens Only

[shanthi priya ramamoorthy]

Hi,
 
Please find the enclosed resume of our consultant and let me know you’re 
interest level. Consultant is open for relocation and available immediately.
 
BA/scrum master Consultant contact details are enclosed in resume.


Thanks,
Shanthi Priya, 
Bench sales recuriter,
Xtramiletechnologies LLC
Mobile: (307) 222-3143
Xtramiletechnologies | New Jersey
Email: pr...@xtramiletechnologies.com
URL: http://xtramiletechnologies.com


On Tuesday, October 25, 2016 at 2:50:33 AM UTC+5:30, Saikiran Nandrolu 
wrote:
>
> Hi Friends,
>
> Hope you are doing great,
>
>  
>
> I have an urgent requirement from one of my esteem client, I will 
> appreciate if you can have an eye on the below requirement and send me your 
> consultant updated profile ASAP.
>
>  
>
> *Scrum Master*
>
> *Location : Bloomington IL*
>
> *Duration : long term*
>
> *EAD or GC or Citizens Only*
>
>  
>
> Top Three Skills: 
>
> 1. Experience as an Scrum Master coordinating agile work efforts
>
> 2. Able to work with multiple resources within IT projects to help drive 
> organizational change adoption to use Agile while coordinating work and 
> meeting facilitation. 
>
> 3. Strong background in Agile techniques such as Scrum, Kanban, LEAN and 
> ScaledAgile Framework SAFe
>
>  
>
> Best Regard
>
> Sai Kiran
>
> saikir...@usmsystems.com
>
> 703-880-4146
>
>  
>

-- 
You received this message because you are subscribed to the Google Groups 
"Android Developers" group.
To unsubscribe from this group and stop receiving emails from it, send an email 
to android-developers+unsubscr...@googlegroups.com.
To post to this group, send email to android-developers@googlegroups.com.
Visit this group at https://groups.google.com/group/android-developers.
To view this discussion on the web visit 
https://groups.google.com/d/msgid/android-developers/44fc62aa-ec94-46f5-975a-452dbd7c1926%40googlegroups.com.
For more options, visit https://groups.google.com/d/optout.


Surya Jagarla.docx
Description: MS-Word 2007 document

[android-developers] Required::::QA with .Net, MS Test Manager - F2F Interview at Columbus, OH

[Priya S]

Hi,

Hope you are doing Good!

This is Priya Technical Recruiter form MSYS, Inc. We have come across your
profile on LinkedIn/Job Boards and we found your profile matching to the
below job description.

*Position:  QA with .Net, MS Test Manager - F2F Interview*

*Location: Columbus, OH*

*Duration: Long Term*

*Description:*

   -

   7 Years in testing I.T products and applications.
   -

   5 Years automation experience using MS Visual Studio Coded UI, Team
   Foundation Server and Microsoft Test Manager
   -

   5 Years Development/scripting skills in C#
   -

   5 Years in End to End Test Automation experience
   -

   5 Years demonstrated experience in converting existing manual test cases
   to automation scripts.
   -

   5 Years conducting test case reviews to ensure scenarios accurately
   capture business functionality.
   -

   Contributes to continuous process improvements to increase the
   efficiency of QA and development.
   -

   Excellent communication skills both written and oral Needs to show at
   least 1 year Quality Assurance experience in a technical capacity with a
   large organization as ODPS.  The experience must encompass the writing of
   test strategies, test scenarios, test plans and test scripts.
   -

   Must have at least 1-year experience working on Agile/Scrum I.T.
   projects.
   -

   Must have experience working with Microsoft Test Manager on at least one
   project



*Thank you!!*

*Priya S.*

*Technical Recruiter*

*MSys Inc.,*

*140 Iowa Lane #201 Cary NC 27511*

*Direct (972) 544 7798*

*pr...@msysinc.com* 

*www.msysinc.com* <http://www.msysinc.com>

-- 
You received this message because you are subscribed to the Google Groups 
"Android Developers" group.
To unsubscribe from this group and stop receiving emails from it, send an email 
to android-developers+unsubscr...@googlegroups.com.
To post to this group, send email to android-developers@googlegroups.com.
Visit this group at https://groups.google.com/group/android-developers.
To view this discussion on the web visit 
https://groups.google.com/d/msgid/android-developers/CABeo%2BGMVuxV_iv%3D9G4oEg2eTOF7QotoPTJ9edhY2JTBVUoRk1w%40mail.gmail.com.
For more options, visit https://groups.google.com/d/optout.

[android-developers] Re: (NEED LOCALS) Business Analyst (Data Warehouse & Reporting) @ Baltimore, MD

[shanthi priya ramamoorthy]

Hi,
 
Please find the enclosed resume of our consultant and let me know you’re 
interest level. Consultant is open for relocation and available immediately.
 
BA/scrum master Consultants contact details are enclosed in resume.


Thanks,
Shanthi Priya, 
Bench sales recuriter,
Xtramiletechnologies LLC
Mobile: (307) 222-3143
Xtramiletechnologies | New Jersey
Email: pr...@xtramiletechnologies.com
URL: http://xtramiletechnologies.com

On Tuesday, October 25, 2016 at 8:35:56 PM UTC+5:30, anudeep Vanamala wrote:
>
> *Title : Business Analyst (Data Warehouse & Reporting)*
>
> *Location : Baltimore, MD*
>
> *Duration : 6 Months(Contract To Hire)*
>
>  
>
>
>
>
> *NEED GC OR USC NEED LOCALS F2F MUST*
>
>  
>
> *Must Have:*
>
> 9+ years’ experience as a Business Analyst including: 
>
> Working in complex projects gathering user requirements and converting 
> them into system requirements that can be tested
>
> Proven experience with supporting highly critical customer missions
>
> Experience with/ understanding of full software development life cycle
>
> Demonstrated good understanding of system engineering
>
> Excellent verbal and written communication skills, including experience 
> working directly with customers to discuss their requirements and objectives
>
> Experience working with data warehouse
>
> Experience working with reporting systems
>
>  
>
> *Nice to Have:*
>
> Prior experience with HP ALM and JIRA
>
> Experience in developing Business Process and Functional Flow diagrams
>
> Prior system integration experience
>
> Experience in Agile methodology
>
> Previous experience with web service development projects
>
> Previous leadership experience
>
>  
>
> *Thanks *
>
> *Anudeep | Anblicks|www.anblicks.com <http://www.anblicks.com>*
>
> *14651 Dallas Parkway, Suite 816, Dallas, TX-75254*
>
> *anud...@anblicks.com *
>
>  
>

-- 
You received this message because you are subscribed to the Google Groups 
"Android Developers" group.
To unsubscribe from this group and stop receiving emails from it, send an email 
to android-developers+unsubscr...@googlegroups.com.
To post to this group, send email to android-developers@googlegroups.com.
Visit this group at https://groups.google.com/group/android-developers.
To view this discussion on the web visit 
https://groups.google.com/d/msgid/android-developers/ca4faf2c-c0fe-40f5-8632-6dd4c612c4d1%40googlegroups.com.
For more options, visit https://groups.google.com/d/optout.


BharaniVadde resume.docx
Description: MS-Word 2007 document


NAGAJ_.docx
Description: MS-Word 2007 document

[android-developers] Re: (NEED LOCALS) Business Analyst (Oracle) @ Baltimore, MD

[shanthi priya ramamoorthy]

Hi,
 
Please find the enclosed resume of our consultant and let me know you’re 
interest level. Consultant is open for relocation and available immediately.
 
BA/scrum master Consultants contact details are enclosed in resume.


Thanks,
Shanthi Priya, 
Bench sales recuriter,
Xtramiletechnologies LLC
Mobile: (307) 222-3143
Xtramiletechnologies | New Jersey
Email: pr...@xtramiletechnologies.com
URL: http://xtramiletechnologies.com

On Tuesday, October 25, 2016 at 8:44:35 PM UTC+5:30, anudeep Vanamala wrote:
>
> *Title : Business Analyst (Oracle)*
>
> *Location : Baltimore, MD*
>
> *Duration : 6 + Months(Contract to Hire)*
>
>  
>
>
>
> *NEED USC OR GC*
>
>
> *NEED LOCALS AND F2F MUST*
>
>  
>
> *Must Have:*
>
> 9+ years’ experience as a Business Analyst including: 
>
> Working in complex projects gathering user requirements and converting 
> them into system requirements that can be tested
>
> Proven experience with supporting highly critical customer missions
>
> Experience with/ understanding of full software development life cycle
>
> Demonstrated good understanding of system engineering
>
> Excellent verbal and written communication skills, including experience 
> working directly with customers to discuss their requirements and objectives
>
> Previous experience working with Oracle databases
>
>  
>
> *Nice to Have:*
>
> Prior experience with HP ALM and JIRA
>
> Experience in developing Business Process and Functional Flow diagrams
>
> Prior system integration experience
>
> Experience in Agile methodology
>
> Previous experience with web service development projects
>
> Previous leadership experience
>
>  
>
> *Thanks *
>
> *Anudeep | Anblicks|www.anblicks.com <http://www.anblicks.com>*
>
> *14651 Dallas Parkway, Suite 816, Dallas, TX-75254*
>
> *anudee...@anblicks.com *
>

-- 
You received this message because you are subscribed to the Google Groups 
"Android Developers" group.
To unsubscribe from this group and stop receiving emails from it, send an email 
to android-developers+unsubscr...@googlegroups.com.
To post to this group, send email to android-developers@googlegroups.com.
Visit this group at https://groups.google.com/group/android-developers.
To view this discussion on the web visit 
https://groups.google.com/d/msgid/android-developers/48a74f40-bb5d-4b10-be06-823e08ce1191%40googlegroups.com.
For more options, visit https://groups.google.com/d/optout.


BharaniVadde resume.docx
Description: MS-Word 2007 document


NAGAJ_.docx
Description: MS-Word 2007 document

[android-developers] Re: Urgent Need---Scrum Master-----EAD or GC or Citizens Only

[shanthi priya ramamoorthy]

Hi,

Hope u doing great please find the attachment for below position


Thanks,
Shanthi Priya, 
Bench sales recuriter,
Xtramiletechnologies LLC
Mobile: (307) 222-3143
Xtramiletechnologies | New Jersey
Email: pr...@xtramiletechnologies.com
URL: http://xtramiletechnologies.com



On Tuesday, October 25, 2016 at 2:50:33 AM UTC+5:30, Saikiran Nandrolu 
wrote:
>
> Hi Friends,
>
> Hope you are doing great,
>
>  
>
> I have an urgent requirement from one of my esteem client, I will 
> appreciate if you can have an eye on the below requirement and send me your 
> consultant updated profile ASAP.
>
>  
>
> *Scrum Master*
>
> *Location : Bloomington IL*
>
> *Duration : long term*
>
> *EAD or GC or Citizens Only*
>
>  
>
> Top Three Skills: 
>
> 1. Experience as an Scrum Master coordinating agile work efforts
>
> 2. Able to work with multiple resources within IT projects to help drive 
> organizational change adoption to use Agile while coordinating work and 
> meeting facilitation. 
>
> 3. Strong background in Agile techniques such as Scrum, Kanban, LEAN and 
> ScaledAgile Framework SAFe
>
>  
>
> Best Regard
>
> Sai Kiran
>
> saikir...@usmsystems.com 
>
> 703-880-4146
>
>  
>

-- 
You received this message because you are subscribed to the Google Groups 
"Android Developers" group.
To unsubscribe from this group and stop receiving emails from it, send an email 
to android-developers+unsubscr...@googlegroups.com.
To post to this group, send email to android-developers@googlegroups.com.
Visit this group at https://groups.google.com/group/android-developers.
To view this discussion on the web visit 
https://groups.google.com/d/msgid/android-developers/3918f300-74ce-48c4-8516-748db71431fb%40googlegroups.com.
For more options, visit https://groups.google.com/d/optout.


BharaniVadde resume.docx
Description: MS-Word 2007 document

[android-developers] Required:::Enterprise Architect (SOA) at Richmond, VA

[Priya S]

Hi,



Hope you are doing Good!



This is Priya Senior Technical Recruiter form MSYS, Inc. We have come
across your profile on LinkedIn/Job Boards and we found your profile
matching to the below job description.



*Position:** Enterprise Architect (SOA)*

*Location:** Richmond, VA*

*Duration: Long Term*



Minimum Qualifications

· Possess strong knowledge in applied application, information, and
integration architecture concepts; possess comprehensive IT analytical
skills and strong problem-solving skills; have a working knowledge of
various multi-user, multi-tasking operating systems/platforms (Unix,
Windows, z/OS); and a working knowledge of various development platforms
(Java, .NET, SharePoint) .  Demonstrated skills to produce relevant
solution design artifacts including but not limited to:  requirements, use
cases, test cases, sequence diagrams, data models, conceptual, logical ,
and physical systems designs; to prepare written communications and
presentations; and be proficiently skilled with Microsoft Visio.

· Deep understanding of web services and various web service
standards including SOAP and REST

· Deep understanding on XML and XML schema concepts

· Deep understanding of reference data and master data as applied
to the storage and provisioning of the data

· Familiarity with Master Data Management (MDM), reference data
management and data warehouses

· Familiarity with normalized data models (e.g. party data model)
and star schemas

· Experience with Service Oriented Architecture (SOA) principles
and practices. Must have designed and implemented reusable services using
SOA principles

· Experience with Service discovery, ,delivery and cataloging

· Experience creating data services from the master database and
make those services available to the entire enterprise

· Experience with hybrid cloud integration

· Experience with secure data gateways

· Experience with Integrating solutions using SOAP, REST and data
adapter APIs

· Experience with a centralized broker such as enterprise service
bus and hub-and-spoke and how they relate to federated and mediation
techniques.

· Experience creating a canonical data model using XML and other
formats and developing services using this model

· A system model that defines the APIs, data flow and rules of
engagement to the system such that components can be built to interface
with it in a standardized way.

Preferred Qualifications

· Experience implementing a roadmap for transitioning to hybrid and
cloud architectures

· Experience implementing modern approaches to integration of
disparate platforms and systems

· Knowledge of transportation business processes and business
culture.

· Experience with process frameworks (like SOA, ITIL or COBIT) and
with Agile approaches to solution delivery.

· Degree in business administration, public administration,
engineering, information technology or related field.

Special Instructions to Applicants

•This position requires a fingerprint-based background check.










*Thanks and Regards,Priys S.Sr.Technical RecruiterDirect (972) 544
7798priyadarshani.s...@gmail.com *

-- 
You received this message because you are subscribed to the Google Groups 
"Android Developers" group.
To unsubscribe from this group and stop receiving emails from it, send an email 
to android-developers+unsubscr...@googlegroups.com.
To post to this group, send email to android-developers@googlegroups.com.
Visit this group at https://groups.google.com/group/android-developers.
To view this discussion on the web visit 
https://groups.google.com/d/msgid/android-developers/CABeo%2BGO-gAM-sKYpP4aPiRtMJqn5mGZW97ycYTgkVTzHdRF%2Brw%40mail.gmail.com.
For more options, visit https://groups.google.com/d/optout.

[android-developers] Required::::IBM Datacap Consultant at Raleigh, NC

[Priya S]

Hi,

Hope you are doing Good!

This is Priya Senior Technical Recruiter form Dynamic Software Services,
Inc. We have come across your profile on LinkedIn/Job Boards and we found
your profile matching to the below job description



*Position:* *IBM Datacap Consultant*

*Location:* *Raleigh, NC*

*Duration: Long Term*



*Description:*

This position will be responsible for developing and managing the
architectural design and implementation of the migration from IBM ImagePlus
to IBM Content Manager 8 and for designing and implementing multiple
document imaging initiatives using both EMC InputAccel and IBM DataCap
solutions.



Description (including, but not limited to):

· This individual will be responsible for all architectural
requirements and artifacts related to the NCDOT Enterprise Document and
Imaging Management (EDIM) project and multiple other DMV document imaging
initiatives.

· The applicant should possess strong knowledge and experience in
integrating and aligning business capabilities, business processes, and
content management. The applicant should also have experience designing and
delivering solutions within an IBM environment, specifically with IBM
Content Manager 8, IBM DataCap, and EMC Captiva InputAccel solutions.

· Prior experiences of the applicant should demonstrate an ability
to directly produce architectural artifacts specifically related to data &
metadata analysis to support a focused search solution.

· This individual will be responsible for but not limited to the
following:

•Managing the architecture requirements of the NCDOT Enterprise
Document and Imaging Management (EDIM) project while working with the
project team.

•Streamlining paper document processes and creating electronic
records and content management processes across multiple capabilities at
DMV.

•Interact with the business and business analysts to gather
relevant requirements for processes and content creation along with the
associated metadata.

•Maintaining a Content Map showing the relationship between
capabilities, processes and content and assist with the prioritization and
ingestion of content into the DMV Content Management System (Content
Manager 8).

•Refine enterprise metadata taxonomy and metadata model with
additional metadata clusters.

•Implementing a Repeatable Solution Delivery Methodology to support
multiple content releases.

•System design to include analysis, design and configuration of
software components to support the DMV Content Management System and
information (data) architectures associated with iterative content releases.

•Work with application teams on understanding line of business
systems as data sources for metadata.

•Collaborate with the Enterprise Architectural team and other
disciplines to ensure that DMV Content Management System aligns with the
departmental Content Management capabilities.



· Expected Skills: Able to work without assistance; can provide
leadership to others; able to manage highly complex work efforts; may have
advanced education; may have extensive industry experience.

Required Skills

   - 10 years Experience in technical disciplines to include systems
   integration, legacy transformation, and enterprise, data, business, and
   technical architectures
   - 5 years Experience in architecture, design, and implementation for an
   enterprise scale IBM Content Manager Environment.
   - 5 years Experience producing architectural artifacts (business, data,
   and technology) to guide the integration of mainframe legacy systems and
   Content Manager
   - 10 years Data and Information architecture experience in analysis,
   design, and implementation roles.
   - 5 years Business process modeling, analysis, automation, and
   implementation
   - 5 years Team oriented individual who leads and works well with
   technical and non-technical resources
   - Tools based data modeling experience with Visio, Erwin, etc. and
   experience with conceptual, logical, and physical data models
   - 5 years Experience in architecture, design, and implementation for an
   enterprise scale DataCap scan capture implementation

Thank you,
Priya S.
Technical Recruiter
priyadarshani.s...@gmail.com

Direct 972-544-7798

-- 
You received this message because you are subscribed to the Google Groups 
"Android Developers" group.
To unsubscribe from this group and stop receiving emails from it, send an email 
to android-developers+unsubscr...@googlegroups.com.
To post to this group, send email to android-developers@googlegroups.com.
Visit this group at https://groups.google.com/group/android-developers.
To view this discussion on the web visit 
https://groups.google.com/d/msgid/android-developers/CABeo%2BGNXBhX7c371ir872GvEB9hGD_Z-tjy%2BZLnhAkt09AxzOg%40mail.gmail.com.
For more options, visit https://groups.google.com/d/optout.

[android-developers] Copy/Paste Multiple content

[Priya Thiagarajan]

I have a new feature that can be added to Android OS. We can use copy 
option to copy the content and paste option will paste only the last copied 
content. What if I wanted to copy multiple contents from multiple places 
and paste in one go, without doing Copy paste on every content? What if I 
wanted to copy all the contents directly to a file? Google can bring up 
this feature bundled within the Android OS SDK itself, as it might be very 
helpful for every one of us. 

-- 
You received this message because you are subscribed to the Google Groups 
"Android Developers" group.
To unsubscribe from this group and stop receiving emails from it, send an email 
to android-developers+unsubscr...@googlegroups.com.
To post to this group, send email to android-developers@googlegroups.com.
Visit this group at https://groups.google.com/group/android-developers.
To view this discussion on the web visit 
https://groups.google.com/d/msgid/android-developers/ffaa97c9-ed30-4e84-b50c-b71a2904d4d1%40googlegroups.com.
For more options, visit https://groups.google.com/d/optout.

Re: [android-developers] Experienced Android developer needed

[priya abc]

I m available .



On Mon, Nov 10, 2014 at 4:30 AM, jtoolsdev  wrote:

> The proper way to do a contract is to have a signing fee which is very
> standard in the industry.  That way you are always ahead moneywise in the
> game.  If they won't do a signing fee that then you don't want to work for
> them.
>
> On Thursday, November 6, 2014 3:16:34 AM UTC-8, vonguyen wrote:
>>
>> Hi Guys,
>>
>> I have worked for this guys in last year. I completed the projects for
>> him but he didn't pay for me.
>>
>> It is a worst guy that I work.
>>
>> Regards,
>>
>> O
>>
>>  --
> You received this message because you are subscribed to the Google
> Groups "Android Developers" group.
> To post to this group, send email to android-developers@googlegroups.com
> To unsubscribe from this group, send email to
> android-developers+unsubscr...@googlegroups.com
> For more options, visit this group at
> http://groups.google.com/group/android-developers?hl=en
> ---
> You received this message because you are subscribed to the Google Groups
> "Android Developers" group.
> To unsubscribe from this group and stop receiving emails from it, send an
> email to android-developers+unsubscr...@googlegroups.com.
> For more options, visit https://groups.google.com/d/optout.
>

-- 
You received this message because you are subscribed to the Google
Groups "Android Developers" group.
To post to this group, send email to android-developers@googlegroups.com
To unsubscribe from this group, send email to
android-developers+unsubscr...@googlegroups.com
For more options, visit this group at
http://groups.google.com/group/android-developers?hl=en
--- 
You received this message because you are subscribed to the Google Groups 
"Android Developers" group.
To unsubscribe from this group and stop receiving emails from it, send an email 
to android-developers+unsubscr...@googlegroups.com.
For more options, visit https://groups.google.com/d/optout.

[android-developers] Set scroll to jquery mobile popup in android 2.2

[mohana priya]

 I am using jquery mobile popup in my phonegap android app.I need to set 
the height to the popup and to scroll when the content exceeds in the 
popup.I have tried some code its working fine in android 4.0 but not 
working in android 2.2.


click here



Close Window

rdgfretwetsvgcnncchdrtrytyfjfhjgfjsdhgjkhshgsjhghsdjghjkgkrdgfretwetsvgcnncchdrtrytyfjfhjgfjsdhgjkhshgsjhghsdjghjkgkrdgfretwetsvgcnncchdrtrytyfjfhjgfjsdhgjkhshgsjhghsdjghjkgkrdgfretwetsvgcnncchdrtrytyfjfhjgfjsdhgjkhshgsjhghsdjghjkgkrdgfretwetsvgcnncchdrtrytyfjfhjgfjsdhgjkhshgsjhghsdjghjkgkrdgfretwetsvgcnncchdrtrytyfjfhjgfjsdhgjkhshgsjhghsdjghjkgkrdgfretwetsvgcnncchdrtrytyfjfhjgfjsdhgjkhshgsjhghsdjghjkgkrdgfretwetsvgcnncchdrtrytyfjfhjgfjsdhgjkhshgsjhghsdjghjkgkrdgfretwetsvgcnncchdrtrytyfjfhjgfjsdhgjkhshgsjhghsdjghjkgkrdgfretwetsvgcnncchdrtrytyfjfhjgfjsdhgjkhshgsjhghsdjghjkgkrdgfretwetsvgcnncchdrtrytyfjfhjgfjsdhgjkhshgsjhghsdjghjkgkrdgfretwetsvgcnncchdrtrytyfjfhjgfjsdhgjkhshgsjhghsdjghjkgkrdgfretwetsvgcnncchdrtrytyfjfhjgfjsdhgjkhshgsjhghsdjghjkgkrdgfretwetsvgcnncchdrtrytyfjfhjgfjsdhgjkhshgsjhghsdjghjkgkrdgfretwetsvgcnncchdrtrytyfjfhjgfrdgfretwetsvgcnncchdrtrytyfjfhjgfjsdhgjkhshgsjhghsdjghjkgkrdgfretwetsvgcnncchdrtrytyfjfhjgfjsdhgjkhshgsjhghsdjghjkgkrdgfretwetsvgcnncchdrtrytyfjfhjgfjsdhgjkhshgsjhghsdjghjkgkrdgfretwetsvgcnncchdrtrytyfjfhjgfjsdhgjkhshgsjhghsdjghjkgkrdgfretwetsvgcnncchdrtrytyfjfhjgfjsdhgjkhshgsjhghsdjghjkgkrdgfretwetsvgcnncchdrtrytyfjfhjgfjsdhgjkhshgsjhghsdjghjkgkrdgfretwetsvgcnncchdrtrytyfjfhjgfjsdhgjkhshgsjhghsdjghjkgkrdgfretwetsvgcnncchdrtrytyfjfhjgfjsdhgjkhshgsjhghsdjghjkgkrdgfretwetsvgcnncchdrtrytyfjfhjgfjsdhgjkhshgsjhghsdjghjkgkrdgfretwetsvgcnncchdrtrytyfjfhjgfjsdhgjkhshgsjhghsdjghjkgkrdgfretwetsvgcnncchdrtrytyfjfhjgfjsdhgjkhshgsjhghsdjghjkgkrdgfretwetsvgcnncchdrtrytyfjfhjgfjsdhgjkhshgsjhghsdjghjkgkrdgfretwetsvgcnncchdrtrytyfjfhjgfjsdhgjkhshgsjhghsdjghjkgkrdgfretwetsvgcnncchdrtrytyfjfhjgfjsdhgjkhshgsjhghsdjghjkgkrdgfretwetsvgcnncchdrtrytyfjfhjgf

css:

.ui-popup
{ position: relative; overflow: scroll; }

Script for setting height:

$( "#popupBasic" ).css( "height","100px");


Please kindly guide me.Thanks in Advance.

-- 
You received this message because you are subscribed to the Google
Groups "Android Developers" group.
To post to this group, send email to android-developers@googlegroups.com
To unsubscribe from this group, send email to
android-developers+unsubscr...@googlegroups.com
For more options, visit this group at
http://groups.google.com/group/android-developers?hl=en

[android-developers] textbox problem in android 4.0

[mohana priya]

   
Hi,I have designed the android phonegap app using jquery mobile.In 
android 4.0 when the textbox gets focused and trying to scroll the page,the 
textbox moves above header and footer.Please help me to solve this 
problem.Thanks 
in Advance.

-- 
You received this message because you are subscribed to the Google
Groups "Android Developers" group.
To post to this group, send email to android-developers@googlegroups.com
To unsubscribe from this group, send email to
android-developers+unsubscr...@googlegroups.com
For more options, visit this group at
http://groups.google.com/group/android-developers?hl=en

Re: [android-developers] Re: Navigation Tabs converted to Drop down on orientation change in Action bar of ICS.

[priya abc]

After tab added to actionBar then setNavigationmode for tab

Tab tabDemo=mTabsAdapter.addTab(bar.newTab().setText("ABC"),.Abc.class, *
null*,"Abc");

.

.

.

bar.setNavigationMode(ActionBar.Navigation_mode_tabs);

it shows tabs in tabbed view mode.

it works for me.



**
**





On Wed, Jul 25, 2012 at 10:57 AM, up2mandori  wrote:

> I saw the sample code below.
> However, this code has to question.
> If the drop-down tab to be changed to reselect the listener does not work.
> If I choose the tab you want to be updated.
> We'll be waiting for quick response.
>
> On Friday, January 13, 2012 8:32:14 PM UTC+9, Sudeep wrote:
>>
>> Hi Guys,
>>
>> I have a query related to Action bar in ICS.
>>
>> As we all know Action bar supports both mode , 1. Navigation Tabs 2.
>> Drop-down Navigation.
>>
>> I have an Activity with Action bar and added Navigation Tabs such that
>> each Tab text is lengthy. (say TAB1, TAB2, TAB3,
>> TAB4. etc...) So the view i will be seeing in the portrait mode
>> will be as shown in snapshot_portrait.png which is attached with this
>> email. If the Tab doesn't fit in Portrait mode, the desired tab can be
>> reached by fling action.
>>
>> Now changing the orientation, the Tabbed view changes to a drop down
>> if all the tabs doesnt fit the entire landscape view width.
>>
>> I wanted to have the same Tabbed views in landscape mode too where
>> fling action can slide the tabs..
>>
>> Please can anybody let me know how can i achieve this.
>>
>> Appreciate your quick reply.
>>
>> Thanks...
>>
>>  --
> You received this message because you are subscribed to the Google
> Groups "Android Developers" group.
> To post to this group, send email to android-developers@googlegroups.com
> To unsubscribe from this group, send email to
> android-developers+unsubscr...@googlegroups.com
> For more options, visit this group at
> http://groups.google.com/group/android-developers?hl=en

-- 
You received this message because you are subscribed to the Google
Groups "Android Developers" group.
To post to this group, send email to android-developers@googlegroups.com
To unsubscribe from this group, send email to
android-developers+unsubscr...@googlegroups.com
For more options, visit this group at
http://groups.google.com/group/android-developers?hl=en

Re: [android-developers] video uploaded from galaxy tab not playing

[mohana priya]

Thanks for your reply.Its playing in vlc media player,but not in strobe 
media player.But i captured video from other mobile devices, and its 
playing well in strobe media player.Please guide me.

On Thursday, October 4, 2012 6:55:32 PM UTC+5:30, Lokesh wrote:
>
> Did u try running it with some other media player in the same tab?
> On Oct 4, 2012 6:29 PM, "mohana priya" > 
> wrote:
>
>> I captured video from samsung galaxy tab (android), and tried to upload 
>> to server. i tried to play the video captured in galaxy tab in strobe media 
>> player,I can able to hear the audio,but video is invisible.
>>
>> When I try from other mobile devices, it's playing fine. Please kindly 
>> guide me. Thanks in Advance
>>
>> -- 
>> You received this message because you are subscribed to the Google
>> Groups "Android Developers" group.
>> To post to this group, send email to 
>> android-d...@googlegroups.com
>> To unsubscribe from this group, send email to
>> android-developers+unsubscr...@googlegroups.com 
>> For more options, visit this group at
>> http://groups.google.com/group/android-developers?hl=en
>
>

-- 
You received this message because you are subscribed to the Google
Groups "Android Developers" group.
To post to this group, send email to android-developers@googlegroups.com
To unsubscribe from this group, send email to
android-developers+unsubscr...@googlegroups.com
For more options, visit this group at
http://groups.google.com/group/android-developers?hl=en

[android-developers] video uploaded from galaxy tab not playing

[mohana priya]

I captured video from samsung galaxy tab (android), and tried to upload to 
server. i tried to play the video captured in galaxy tab in strobe media 
player,I can able to hear the audio,but video is invisible.

When I try from other mobile devices, it's playing fine. Please kindly 
guide me. Thanks in Advance

-- 
You received this message because you are subscribed to the Google
Groups "Android Developers" group.
To post to this group, send email to android-developers@googlegroups.com
To unsubscribe from this group, send email to
android-developers+unsubscr...@googlegroups.com
For more options, visit this group at
http://groups.google.com/group/android-developers?hl=en

[android-developers] unable to open the local database in android

[mohana priya]

I have service in android,from that service i started an activity.I
called the method inside the activity from service.In that method,i
open the database and tried to insert the values.Without using
database,its working fine.But my app getting force closed when i used
database


plugin(java file)-->service-->Activity(here i try to insert the data
in database)

**service.java**

public class MyService extends Service
{
@Override
public IBinder onBind(Intent intent)
{
return null;
}

@Override
public void onCreate()
{
Log.d(TAG, "onCreate");
}

@Override
public void onDestroy()
{
Log.d(TAG, "onDestroy");
}

public void onStart(Intent intent, int startid)
{
Timer mTimer = new Timer(user);
mTimer.scheduleAtFixedRate(new mainTask(), 5000,6);//1
hour=3600 s

}

private class mainTask extends TimerTask
{
public void run()
{
toastHandler.sendEmptyMessage(0);
}
}


private final Handler toastHandler = new Handler()
{
public void handleMessage(Message msg)
{
 StorageHelper s=new StorageHelper();
 String a= s.UpdateValues(userid);
}
};

 }

**Activity.java**

public class StorageHelper extends Activity
{
@Override
public void onCreate(Bundle savedInstanceState)
{
super.onCreate(savedInstanceState);
}

 public  String UpdateValues(int userid)
{

try {
 DBAdapter1 database=new DBAdapter1(this);
database.open();
long id=database.insert(71,4,"yes");
database.close();
} catch (SQLException e) {
}

return "success";
}
}

**Note**
when i open the database in oncreate its working,But inside the
updatavalues() database cannot open to insert.


   try {
 DBAdapter1 database=new DBAdapter1(this);
database.open();
long id=database.insert(71,4,"yes");
database.close();
} catch (SQLException e) {
}

i got two type of force close


Error number 1

07-09 15:16:27.859: E/AndroidRuntime(1211): FATAL EXCEPTION: main
07-09 15:16:27.859: E/AndroidRuntime(1211):
java.lang.NullPointerException
07-09 15:16:27.859: E/AndroidRuntime(1211): at
android.content.ContextWrapper.openOrCreateDatabase(ContextWrapper.java:
203)
07-09 15:16:27.859: E/AndroidRuntime(1211): at
android.database.sqlite.SQLiteOpenHelper.getWritableDatabase(SQLiteOpenHelper.java:
98)
07-09 15:16:27.859: E/AndroidRuntime(1211): at
com.app.mobilyzer.DBAdapter1.open(DBAdapter1.java:68)
07-09 15:16:27.859: E/AndroidRuntime(1211): at
com.app.mobilyzer.StorageHelper.UpdateValues(StorageHelper.java:33)
07-09 15:16:27.859: E/AndroidRuntime(1211): at
com.app.mobilyzer.MyService$1.handleMessage(MyService.java:121)
07-09 15:16:27.859: E/AndroidRuntime(1211): at
android.os.Handler.dispatchMessage(Handler.java:99)
07-09 15:16:27.859: E/AndroidRuntime(1211): at
android.os.Looper.loop(Looper.java:123)
07-09 15:16:27.859: E/AndroidRuntime(1211): at
android.app.ActivityThread.main(ActivityThread.java:4627)
07-09 15:16:27.859: E/AndroidRuntime(1211): at
java.lang.reflect.Method.invokeNative(Native Method)
07-09 15:16:27.859: E/AndroidRuntime(1211): at
java.lang.reflect.Method.invoke(Method.java:521)
07-09 15:16:27.859: E/AndroidRuntime(1211): at
com.android.internal.os.ZygoteInit
$MethodAndArgsCaller.run(ZygoteInit.java:868)
07-09 15:16:27.859: E/AndroidRuntime(1211): at
com.android.internal.os.ZygoteInit.main(ZygoteInit.java:626)
07-09 15:16:27.859: E/AndroidRuntime(1211): at
dalvik.system.NativeStart.main(Native Method)

Error number 2

07-09 15:16:36.889: E/AndroidRuntime(1237): FATAL EXCEPTION: main
07-09 15:16:36.889: E/AndroidRuntime(1237):
java.lang.RuntimeException: Unable to start service
com.app.mobilyzer.MyService@44fc6280 with null:
java.lang.NullPointerException
07-09 15:16:36.889: E/AndroidRuntime(1237): at
android.app.ActivityThread.handleServiceArgs(ActivityThread.java:3063)
07-09 15:16:36.889: E/AndroidRuntime(1237): at
android.app.ActivityThread.access$3600(ActivityThread.java:125)
07-09 15:16:36.889: E/AndroidRuntime(1237): at
android.app.ActivityThread$H.handleMessage(Activi

[android-developers] send message

[Priya Mehta]

how can i send message in the background without any notification to the
user

-- 
You received this message because you are subscribed to the Google
Groups "Android Developers" group.
To post to this group, send email to android-developers@googlegroups.com
To unsubscribe from this group, send email to
android-developers+unsubscr...@googlegroups.com
For more options, visit this group at
http://groups.google.com/group/android-developers?hl=en

[android-developers] Code to send mail not working

[Priya Mehta]

Button b2=(Button)findViewById(R.id.btnmail);
b1.setOnClickListener(new View.OnClickListener() {
 public void onClick(View v) {
// TODO Auto-generated method stub
 Intent intent = new Intent(Intent.ACTION_SENDTO);
  Uri uri = Uri.parse("mailto:priya.mehta...@gmail.com";);
  intent.setData(uri);
  intent.putExtra("subject", "my subject");
  intent.putExtra("body", "my message");
  startActivity(intent);
}
});

-- 
You received this message because you are subscribed to the Google
Groups "Android Developers" group.
To post to this group, send email to android-developers@googlegroups.com
To unsubscribe from this group, send email to
android-developers+unsubscr...@googlegroups.com
For more options, visit this group at
http://groups.google.com/group/android-developers?hl=en

[android-developers] Add additional blank element or "select" string in SimpleCursorAdapter for spinner

[priya abc]

Hello,


Spinner spIdentification1=(Spinner) findViewById(R.id.spinner1);

 Cursor cursorIdentification= *this*.dbH1.getReadableDatabase().query(
"MasterIdentifierType",*new* String[] { "IdentifierTypeUid _id",
"ExternalID","ObjectName", "Description", "ListOrder","CreatedDate",
"CreatedByUid", "ModifiedDate","ModifiedByUid" },   //define cursor data

*null*, *null*, *null*, *null*, *null*);

SimpleCursorAdapter adpIdenti== *new* SimpleCursorAdapter(*context*
,android.R.layout.*simple_spinner_item*, cursorIdentification, *new*String[] {
"Description" }, *new* *int*[] { android.R.id.*text1* });//creating
adapter

adpIdenti.setDropDownViewResource(android.R.layout.*
simple_spinner_dropdown_item*);

spIdentification1.setAdapter(adpIdenti);





i want to add one extra element into simplecursoradapter as blank or
"select .." but i am not able to add it

i want fist element null or blank or "select ...":

Thanks in adavance.



Regards,

Pranita Patil

-- 
You received this message because you are subscribed to the Google
Groups "Android Developers" group.
To post to this group, send email to android-developers@googlegroups.com
To unsubscribe from this group, send email to
android-developers+unsubscr...@googlegroups.com
For more options, visit this group at
http://groups.google.com/group/android-developers?hl=en

[android-developers] tablet is hang due to full internal storage memory

[priya abc]

Hello,

I run application from eclipse .it installed directly on tablet internal
memory storage.that` why it memory is almost full.
Then I am trying to uninstall it but it is not removing.
So i just power off the tablet and did power on..but it is not going into
home screen ...it showing only starting logo.
Now What should i do?

It is china tablet 7inch ...model is crane v1.4 somthing like that.

-- 
You received this message because you are subscribed to the Google
Groups "Android Developers" group.
To post to this group, send email to android-developers@googlegroups.com
To unsubscribe from this group, send email to
android-developers+unsubscr...@googlegroups.com
For more options, visit this group at
http://groups.google.com/group/android-developers?hl=en

[android-developers] How to change the design size of the application for each and every mobiles

[mohana priya]

I have designed my phonegap android application using html and
javascript.This application is for mobile.So i want to know how to get
the same design size in all the mobiles.Is there any settings
available.Please tell me the solution.Thanks in Advance.

-- 
You received this message because you are subscribed to the Google
Groups "Android Developers" group.
To post to this group, send email to android-developers@googlegroups.com
To unsubscribe from this group, send email to
android-developers+unsubscr...@googlegroups.com
For more options, visit this group at
http://groups.google.com/group/android-developers?hl=en

[android-developers] application with same size in all the mobile

[mohana priya]

I have created the phonegap android application.I need to get the
application with same design size in all the mobile.Please tell me the
solution.Thanks in Advance.

-- 
You received this message because you are subscribed to the Google
Groups "Android Developers" group.
To post to this group, send email to android-developers@googlegroups.com
To unsubscribe from this group, send email to
android-developers+unsubscr...@googlegroups.com
For more options, visit this group at
http://groups.google.com/group/android-developers?hl=en

[android-developers] how to retrieve contact image from contacts in android phonegap application

[mohana priya]

Hello Android developers.In my android phonegap application, i want to
retrieve the contact image from contacts in the android mobile using
javascript.Please tell me how to do so.Thanks in Advance.

-- 
You received this message because you are subscribed to the Google
Groups "Android Developers" group.
To post to this group, send email to android-developers@googlegroups.com
To unsubscribe from this group, send email to
android-developers+unsubscr...@googlegroups.com
For more options, visit this group at
http://groups.google.com/group/android-developers?hl=en

[android-developers] types of emulators

[mohana priya]

Hello android developers.For Motorola,Samsung etc. is there different
emulator for each in android.If so please tell me how to get the
emulator for Motorola.Thanks in Advance.

-- 
You received this message because you are subscribed to the Google
Groups "Android Developers" group.
To post to this group, send email to android-developers@googlegroups.com
To unsubscribe from this group, send email to
android-developers+unsubscr...@googlegroups.com
For more options, visit this group at
http://groups.google.com/group/android-developers?hl=en

[android-developers] emulator for motorola droid x

[mohana priya]

Hello android developers.can u please tell me How and where to
download the motorola droid x emulator for android application with
phonegap.Thanks in Advance.

-- 
You received this message because you are subscribed to the Google
Groups "Android Developers" group.
To post to this group, send email to android-developers@googlegroups.com
To unsubscribe from this group, send email to
android-developers+unsubscr...@googlegroups.com
For more options, visit this group at
http://groups.google.com/group/android-developers?hl=en

[android-developers] Re: How to call the activity class

[mohana priya]

Thanks for your reply.My application is phonegap in android.I need to
call the activity class from the class which extends plugin in android
phonegap application.How to do so.I have used the intent.but
startactivity(intent) is undefined inside the plugins.Please tell me
the solution.Thanks in Advance.

On Nov 25, 9:40 pm, Kumar Bibek  wrote:
> Your question is not clear.
>
> Please clarify by giving more details.
>
> On Nov 25, 7:21 pm, mohana priya  wrote:
>
> > Hello android developers.I need to call the activity class inside the
> > java class,because i need to do the application in phonegap.Please
> > tell me the solution.Thanks in Advance.

-- 
You received this message because you are subscribed to the Google
Groups "Android Developers" group.
To post to this group, send email to android-developers@googlegroups.com
To unsubscribe from this group, send email to
android-developers+unsubscr...@googlegroups.com
For more options, visit this group at
http://groups.google.com/group/android-developers?hl=en

[android-developers] How to call the activity class

[mohana priya]

Hello android developers.I need to call the activity class inside the
java class,because i need to do the application in phonegap.Please
tell me the solution.Thanks in Advance.

-- 
You received this message because you are subscribed to the Google
Groups "Android Developers" group.
To post to this group, send email to android-developers@googlegroups.com
To unsubscribe from this group, send email to
android-developers+unsubscr...@googlegroups.com
For more options, visit this group at
http://groups.google.com/group/android-developers?hl=en

[android-developers] to start an activity

[mohana priya]

Hello android developers.I want to know whether we can start the
activity life cycle manually in android.Please reply me.Thanks in
Advance.

-- 
You received this message because you are subscribed to the Google
Groups "Android Developers" group.
To post to this group, send email to android-developers@googlegroups.com
To unsubscribe from this group, send email to
android-developers+unsubscr...@googlegroups.com
For more options, visit this group at
http://groups.google.com/group/android-developers?hl=en

[android-developers] video stream using rtmp

[mohana priya]

Hello In my android application i need to publish the video file to
the server using rtmp client.I want to know whether it is possible to
do streaming in android using rtmp.If so how to do.Please give me the
code.Kindly help me.Thanks in Advance.

-- 
You received this message because you are subscribed to the Google
Groups "Android Developers" group.
To post to this group, send email to android-developers@googlegroups.com
To unsubscribe from this group, send email to
android-developers+unsubscr...@googlegroups.com
For more options, visit this group at
http://groups.google.com/group/android-developers?hl=en

Re: [android-developers] Access ImageView from another activity

[priya Thete]

Hi, following is my project code

import android.app.Activity;
import android.content.Intent;
import android.os.Bundle;
import android.view.View;
import android.view.View.OnClickListener;
import android.widget.ImageButton;
import android.widget.ImageView;

//this is code for first activity, in which i take 4 buttons
public class PpppActivity extends Activity {
/** Called when the activity is first created. */
ImageButton btn1=(ImageButton) findViewById(R.id.imageButton1);
ImageButton btn2=(ImageButton) findViewById(R.id.imageButton2);
ImageButton btn3=(ImageButton) findViewById(R.id.imageButton3);
ImageButton btn4=(ImageButton) findViewById(R.id.imageButton4);
Activity1 ac1=new Activity1();
 @Override
public void onCreate(Bundle savedInstanceState) {
super.onCreate(savedInstanceState);
setContentView(R.layout.main);


btn1.setOnClickListener(new OnClickListener() {

   @Override
   public void onClick(View v) {
// TODO Auto-generated method stub
Activity1.getInstanceCount();
  ac1.getIv();
  ac1.iv.setImageResource(R.drawable.apple);

   }
  });


}


}

*


*

//This is second activity, where i take one imageview, n on that want to
display differnt images one for each button click

 public *class* Activity1 *extends* Activity{

 /** Called when the activity is first created. */

*final* ImageView iv=(ImageView) findViewById(R.id.*imageView1*);

@Override

*public* *void* onCreate(Bundle savedInstanceState) {

*super*.onCreate(savedInstanceState);

setContentView(R.layout.*main11*);

}

*public* ImageView getIv() {

*return* iv;

}

}


On Tue, Oct 25, 2011 at 2:48 PM, Ratheesh Valamchuzhy
wrote:

> hi
>
> give  ur project file
>
> thnks
>
> --
> You received this message because you are subscribed to the Google
> Groups "Android Developers" group.
> To post to this group, send email to android-developers@googlegroups.com
> To unsubscribe from this group, send email to
> android-developers+unsubscr...@googlegroups.com
> For more options, visit this group at
> http://groups.google.com/group/android-developers?hl=en
>



-- 
û Consider the environment.

-- 
You received this message because you are subscribed to the Google
Groups "Android Developers" group.
To post to this group, send email to android-developers@googlegroups.com
To unsubscribe from this group, send email to
android-developers+unsubscr...@googlegroups.com
For more options, visit this group at
http://groups.google.com/group/android-developers?hl=en

Re: [android-developers] Access ImageView from another activity

[priya Thete]

hye dr, i have tried that, but not working.
Do u have any sample code, which i can implement, if yes, plz send me.

On Tue, Oct 25, 2011 at 2:30 PM, Ratheesh Valamchuzhy
wrote:

> hi
>
>
> pass the value(image information) to the next activity(activity2)  using
> puextra method.
>
>
> thnks
>
>  --
> You received this message because you are subscribed to the Google
> Groups "Android Developers" group.
> To post to this group, send email to android-developers@googlegroups.com
> To unsubscribe from this group, send email to
> android-developers+unsubscr...@googlegroups.com
> For more options, visit this group at
> http://groups.google.com/group/android-developers?hl=en
>



-- 
û Consider the environment.

-- 
You received this message because you are subscribed to the Google
Groups "Android Developers" group.
To post to this group, send email to android-developers@googlegroups.com
To unsubscribe from this group, send email to
android-developers+unsubscr...@googlegroups.com
For more options, visit this group at
http://groups.google.com/group/android-developers?hl=en

[android-developers] Access ImageView from another activity

[Priya Thete]

Hi guys, I am developing an application in which i have 10 buttons in
one activity, n in another activity say Activity2, i have an
imageview, when i clicked on button in Activity1, i want to display an
image in imageview of activity2, on every button click, i want to
display differnt images, but i am unable to understand that how can i
trace that buttons, which one i clicked n how i set differnt images on
differnt button click.
Please help me, its too urgent to me.

-- 
You received this message because you are subscribed to the Google
Groups "Android Developers" group.
To post to this group, send email to android-developers@googlegroups.com
To unsubscribe from this group, send email to
android-developers+unsubscr...@googlegroups.com
For more options, visit this group at
http://groups.google.com/group/android-developers?hl=en

[android-developers] video file publishing in android

[mohana priya]

Hello android developers.I need to create an application for video
file publishing to the server in android using rtmp client.
Here is the sample code which i have tried
http://code.google.com/p/android-rtmp-client/downloads/detail?name=rtmp_client_src.zip&can=2&q=
first i have tried this sample code in java using rtmp client and it
works fine.The same code i have tried in android by creating the
object of the java class,but am getting the error

caused by java.lang.NullPointerException
at
org.apache.harmony.nio.internal.SelectorImpl.wakeup(SelectorImpl.java:
418)
at
org.apache.mina.transport.socket.nio.NioSocketConnector.wakeup(NioSocketConnector.java
:295)
at
org.apache.mina.core.polling.AbstractPollingIoConnector.connect0(AbstractPollingIoConnector.
java:345)
at
org.apache.mina.core.service.AbstractIoConnector.connect(AbstractIoConnector.java:
262)
at
org.apache.mina.core.service.AbstractIoConnector.connect(AbstractIoConnector.java:
172)
at org.red5.server.net.rtmp.RTMPClient.startConnector(RTMPClient.java:
80)
at
org.red5.server.net.rtmp.BaseRTMPClientHandler.connect(BaseRTMPClientHandler.java:
244)
at
com.ryong21.example.publisher.PublishClient.start(PublishClient.java:
79)
at com.ryong21.example.publisher.Publisher.main(Publisher.java:35)
at
com.ryong21.example.RtmpclientActivity.onCreate(RtmpclientActivity.java:
37)

Please tell me where i am wrong or else give any sample code for video
file publishing using rtmp client in android.Thanks in Advance.

-- 
You received this message because you are subscribed to the Google
Groups "Android Developers" group.
To post to this group, send email to android-developers@googlegroups.com
To unsubscribe from this group, send email to
android-developers+unsubscr...@googlegroups.com
For more options, visit this group at
http://groups.google.com/group/android-developers?hl=en

[android-developers] video publishing

[mohana priya]

I am new to video publish in android.I need the code to publish the
video in server using android (rtmp) .Please tell the solution.Thanks
in advance.

-- 
You received this message because you are subscribed to the Google
Groups "Android Developers" group.
To post to this group, send email to android-developers@googlegroups.com
To unsubscribe from this group, send email to
android-developers+unsubscr...@googlegroups.com
For more options, visit this group at
http://groups.google.com/group/android-developers?hl=en

[android-developers] How to send a message using sendDataMessage() for more than 133 bytes in android?

[priya]

I am developing an SMS application where i am sending a message using
sendDataMessage function of API level 3,but if i try to send more than
133 bytes i am getting a null pointer exception as shown below

WARN/System.err(223):java.lang.NullPointerException WARN/
System.err(223):at android.telephony.SmsMessage$SubmitPdu.
(SmsMessage.java:100) WARN/System.err(223):at
android.telephony.SmsMessage.getSubmitPdu(SmsMessage.java:425) WARN/
System.err(223):at
android.telephony.SmsManager.sendDataMessage(SmsManager.java:196)

Is there any other method which sends more than 133 bytes in a single
shot.?

-- 
You received this message because you are subscribed to the Google
Groups "Android Developers" group.
To post to this group, send email to android-developers@googlegroups.com
To unsubscribe from this group, send email to
android-developers+unsubscr...@googlegroups.com
For more options, visit this group at
http://groups.google.com/group/android-developers?hl=en

[android-developers] Re: capture video

[mohana priya]

Thanks for your reply.I used your sample for capturing video.But when
i run the application in my emulator i am getting the alert,sorry this
video cannot be played.Please tell me the solution.Thanks in Advance.

On Oct 12, 11:36 am, Indicator Veritatis  wrote:
> See the SimpleVideo example in the download files for  Chapter 10 of
> Android In Action, which source files you can download 
> fromhttp://code.google.com/p/android-in-action/
>
> On Oct 11, 10:28 pm, mohana priya  wrote:
>
> > I am created new instance of class for camera.I need to know how to
> > capture video in android.Please tell me how to do so .Thanks in
> > Advance.

-- 
You received this message because you are subscribed to the Google
Groups "Android Developers" group.
To post to this group, send email to android-developers@googlegroups.com
To unsubscribe from this group, send email to
android-developers+unsubscr...@googlegroups.com
For more options, visit this group at
http://groups.google.com/group/android-developers?hl=en

[android-developers] Re: capture video

[mohana priya]

Thanks for Your reply Sir.I used your sample for capturing the
video.But when i run the application in my emulator i am getting the
alertsorry.this video cannot be played.Please tell the solution
what to do so.Thanks in Advance.

On Oct 12, 11:36 am, Indicator Veritatis  wrote:
> See the SimpleVideo example in the download files for  Chapter 10 of
> Android In Action, which source files you can download 
> fromhttp://code.google.com/p/android-in-action/
>
> On Oct 11, 10:28 pm, mohana priya  wrote:
>
> > I am created new instance of class for camera.I need to know how to
> > capture video in android.Please tell me how to do so .Thanks in
> > Advance.

-- 
You received this message because you are subscribed to the Google
Groups "Android Developers" group.
To post to this group, send email to android-developers@googlegroups.com
To unsubscribe from this group, send email to
android-developers+unsubscr...@googlegroups.com
For more options, visit this group at
http://groups.google.com/group/android-developers?hl=en

[android-developers] Free lancers / Expert for developing eLearning assignments on Android Tabs

[Priya]

Hi ,

Want add an interactive elearning module in the elearning package
being developed on Android tabs.

Is there anyone who 1st hand experience on multi-user intearctive
android based apps development.

Feel free to connect with me  at priya(dot)positions(at)gmail(dot)com

Priya

-- 
You received this message because you are subscribed to the Google
Groups "Android Developers" group.
To post to this group, send email to android-developers@googlegroups.com
To unsubscribe from this group, send email to
android-developers+unsubscr...@googlegroups.com
For more options, visit this group at
http://groups.google.com/group/android-developers?hl=en

[android-developers] capture video

[mohana priya]

I am created new instance of class for camera.I need to know how to
capture video in android.Please tell me how to do so .Thanks in
Advance.

-- 
You received this message because you are subscribed to the Google
Groups "Android Developers" group.
To post to this group, send email to android-developers@googlegroups.com
To unsubscribe from this group, send email to
android-developers+unsubscr...@googlegroups.com
For more options, visit this group at
http://groups.google.com/group/android-developers?hl=en

[android-developers] Video streaming

[mohana priya]

Hello android developers.In my android application i need to capture
the video instead of capturing picture.Please tell how to do so.Please
tell me the solution.Thanks in advance.

-- 
You received this message because you are subscribed to the Google
Groups "Android Developers" group.
To post to this group, send email to android-developers@googlegroups.com
To unsubscribe from this group, send email to
android-developers+unsubscr...@googlegroups.com
For more options, visit this group at
http://groups.google.com/group/android-developers?hl=en

[android-developers] phone gap

[mohana priya]

what is the difference between android phone gap and blackberry
phonegap

-- 
You received this message because you are subscribed to the Google
Groups "Android Developers" group.
To post to this group, send email to android-developers@googlegroups.com
To unsubscribe from this group, send email to
android-developers+unsubscr...@googlegroups.com
For more options, visit this group at
http://groups.google.com/group/android-developers?hl=en

[android-developers] fragment in android

[mohana priya]

I am new to android.i need to divide the android screen using
fragment.But i dont know how to do.If anybody know how to code please
tell me.

-- 
You received this message because you are subscribed to the Google
Groups "Android Developers" group.
To post to this group, send email to android-developers@googlegroups.com
To unsubscribe from this group, send email to
android-developers+unsubscr...@googlegroups.com
For more options, visit this group at
http://groups.google.com/group/android-developers?hl=en

[android-developers] frame in spinner control

[mohana priya]

I am using tabs in my application.When am clicking the spinner i need
to get the frame in right side of the spinner .I want to create the
frame dynamically.Any one tell me the solution.

-- 
You received this message because you are subscribed to the Google
Groups "Android Developers" group.
To post to this group, send email to android-developers@googlegroups.com
To unsubscribe from this group, send email to
android-developers+unsubscr...@googlegroups.com
For more options, visit this group at
http://groups.google.com/group/android-developers?hl=en

[android-developers] frames in button click event

[mohana priya]

I am using tabs in my application.When am clicking the button i need
to get the frame in right side of the button.I want to create the
frame dynamically.Any one tell me the solution.

-- 
You received this message because you are subscribed to the Google
Groups "Android Developers" group.
To post to this group, send email to android-developers@googlegroups.com
To unsubscribe from this group, send email to
android-developers+unsubscr...@googlegroups.com
For more options, visit this group at
http://groups.google.com/group/android-developers?hl=en

[android-developers] Re: application should not exists

[mohana priya]

Yes how to recover that

On Sep 1, 6:44 am, James  wrote:
> Then things will be clear if you run log cat, There must be some
> exceptions uncaught in your code :-)
>
>  On Aug 31, 2:12 pm, mohana priya  wrote:
>
> > Thanks for your reply but am getting error as force close.
>
> > On Aug 30, 12:49 pm, James <030440...@163.com> wrote:
>
> > > It's just paused, not closed. When the call finishes and you come
> > > back. Camera would resume.
> > > This is the android way of multi-task.
>
> > > On Aug 29, 9:15 pm,mohanapriya wrote:
>
> > > > Am in a camera and if any interruption occurs or if i need to attend
> > > > the calls the application gets close.But for me the application should
> > > > not get closed.Any one give some suggestions for this problem .I need
> > > > the coding.
>
>

-- 
You received this message because you are subscribed to the Google
Groups "Android Developers" group.
To post to this group, send email to android-developers@googlegroups.com
To unsubscribe from this group, send email to
android-developers+unsubscr...@googlegroups.com
For more options, visit this group at
http://groups.google.com/group/android-developers?hl=en

[android-developers] Live Video Streaming

[mohana priya]

I am new to android.I need to know how to code for rtmp client in
android for video live streaming.Any one tell me the idea how to do..

-- 
You received this message because you are subscribed to the Google
Groups "Android Developers" group.
To post to this group, send email to android-developers@googlegroups.com
To unsubscribe from this group, send email to
android-developers+unsubscr...@googlegroups.com
For more options, visit this group at
http://groups.google.com/group/android-developers?hl=en

[android-developers] Re: application should not exists

[mohana priya]

Thanks for your reply but am getting error as force close.

On Aug 30, 12:49 pm, James <030440...@163.com> wrote:
> It's just paused, not closed. When the call finishes and you come
> back. Camera would resume.
> This is the android way of multi-task.
>
> On Aug 29, 9:15 pm, mohanapriya  wrote:
>
> > Am in a camera and if any interruption occurs or if i need to attend
> > the calls the application gets close.But for me the application should
> > not get closed.Any one give some suggestions for this problem .I need
> > the coding.
>
>

-- 
You received this message because you are subscribed to the Google
Groups "Android Developers" group.
To post to this group, send email to android-developers@googlegroups.com
To unsubscribe from this group, send email to
android-developers+unsubscr...@googlegroups.com
For more options, visit this group at
http://groups.google.com/group/android-developers?hl=en

[android-developers] exit camera

[mohana priya]

am in a camera mode and if any interruption occurs or if need to
attend the calls the application gets closed or exception occurs.But
for me application should not get closed.Any one give suggestions
through coding

-- 
You received this message because you are subscribed to the Google
Groups "Android Developers" group.
To post to this group, send email to android-developers@googlegroups.com
To unsubscribe from this group, send email to
android-developers+unsubscr...@googlegroups.com
For more options, visit this group at
http://groups.google.com/group/android-developers?hl=en

RE: [android-developers] Web View Error

[Lakshmi Priya]

Hi Mark:

I am trying to locate this.  Could you confirm if the code is ok.

Thanks
..Priya

-Original Message-
From: android-developers@googlegroups.com
[mailto:android-developers@googlegroups.com] On Behalf Of Mark Murphy
Sent: Wednesday, August 24, 2011 10:45 PM
To: android-developers@googlegroups.com
Subject: Re: [android-developers] Web View Error

Use adb logcat, DDMS, or the DDMS perspective in Eclipse to examine
LogCat and look at the stack trace associated with your error.

On Wed, Aug 24, 2011 at 1:12 PM, Lakshmi Priya
 wrote:
> Hi all:
>
>
>
> Please see attached the code I have written for web view..When I run the
> code I get the following error every time.
>
>
>
> Sorry The application WebViewDemo(process org.example.webviewdemo)has
> stopped unexpectedly.Please try again.
>
>
>
> Can someone help me please.
>
>
>
> Thanks
>
> ..Priya
>
>
>
> lakshmi_pr...@simply-logic.com
>
>
>
>
>
> --
> You received this message because you are subscribed to the Google
> Groups "Android Developers" group.
> To post to this group, send email to android-developers@googlegroups.com
> To unsubscribe from this group, send email to
> android-developers+unsubscr...@googlegroups.com
> For more options, visit this group at
> http://groups.google.com/group/android-developers?hl=en



-- 
Mark Murphy (a Commons Guy)
http://commonsware.com | http://github.com/commonsguy
http://commonsware.com/blog | http://twitter.com/commonsguy

Android Training in NYC: http://marakana.com/training/android/

-- 
You received this message because you are subscribed to the Google
Groups "Android Developers" group.
To post to this group, send email to android-developers@googlegroups.com
To unsubscribe from this group, send email to
android-developers+unsubscr...@googlegroups.com
For more options, visit this group at
http://groups.google.com/group/android-developers?hl=en

-- 
You received this message because you are subscribed to the Google
Groups "Android Developers" group.
To post to this group, send email to android-developers@googlegroups.com
To unsubscribe from this group, send email to
android-developers+unsubscr...@googlegroups.com
For more options, visit this group at
http://groups.google.com/group/android-developers?hl=en

[android-developers] Web View Error

[Lakshmi Priya]

Hi all:

 

Please see attached the code I have written for web view..When I run the
code I get the following error every time.

 

Sorry The application WebViewDemo(process org.example.webviewdemo)has
stopped unexpectedly.Please try again.

 

Can someone help me please.

 

Thanks

..Priya

 

lakshmi_pr...@simply-logic.com

 

 

-- 
You received this message because you are subscribed to the Google
Groups "Android Developers" group.
To post to this group, send email to android-developers@googlegroups.com
To unsubscribe from this group, send email to
android-developers+unsubscr...@googlegroups.com
For more options, visit this group at
http://groups.google.com/group/android-developers?hl=enpackage org.example.webviewdemo;

import android.app.Activity;
import android.content.Intent;
import android.net.Uri;
import android.os.Bundle;
import android.view.KeyEvent;
import android.view.View;
import android.view.View.OnClickListener;
import android.view.View.OnKeyListener;
import android.webkit.WebChromeClient;
import android.webkit.WebView;
import android.webkit.WebViewClient;
import android.widget.Button;
import android.widget.EditText;


public class WebViewDemoActivity extends Activity {
private WebView webView;
private EditText urlField;
private Button search;
/** Called when the activity is first created. */
@Override
public void onCreate(Bundle savedInstanceState) {
super.onCreate(savedInstanceState);
setContentView(R.layout.main);

 // Create reference to UI elements
webView  = (WebView) findViewById(R.id.webview_compontent);
webView.setWebChromeClient(new WebChromeClient());
   // webView.setWebViewClient(new HelloWebViewClient());
webView.getSettings().setJavaScriptEnabled(true);
webView.loadUrl("http://www.google.com/";);
//urlField = (EditText)findViewById(R.id.url);


// workaround so that the default browser doesn't take over
webView.setWebViewClient(new MyWebViewClient());

// Setup click listener
search = (Button)findViewById(R.id.Search);
search.setOnClickListener( new OnClickListener() {
public void onClick(View view) {
openURL();
}
});

// Setup key listener
urlField.setOnKeyListener( new OnKeyListener() {
public boolean onKey(View view, int keyCode, KeyEvent event) {
if(keyCode==KeyEvent.KEYCODE_ENTER) {
openURL();
return true;
} else {
return false;
}
}
});
 
}

/** Opens the URL in a browser */
private void openURL() {
webView.loadUrl(urlField.getText().toString());
//webView.requestFocus();
}

private class MyWebViewClient extends WebViewClient {
@Override
public boolean shouldOverrideUrlLoading(WebView view, String url) {
view.loadUrl(url);
return true;

}
public void onClick(View v)
{

String url=null;
// TODO Auto-generated method stub
// Otherwise, the link is not for a page on my site, so launch another 
Activity that handles URLs
Intent intent = new Intent(Intent.ACTION_VIEW, Uri.parse(url));
startActivity(intent);
//return true;

}
}
}
http://schemas.android.com/apk/res/android";
  package="org.example.webviewdemo"
  android:versionCode="1"
  android:versionName="1.0">













http://schemas.android.com/apk/res/android";
android:orientation="vertical"
android:layout_width="fill_parent"
android:layout_height="fill_parent"
>


  
   










  

[android-developers] Link to a website...

[Priya]

I am developing an app in android and the search button in the
application needs to be linked to a website and I am unable to do that
- Can anyone help me with this...

I have pasted the code below...

package com.apache;

import java.io.BufferedReader;
import java.io.InputStreamReader;

import org.apache.http.HttpResponse;
import org.apache.http.client.HttpClient;
import org.apache.http.client.methods.HttpGet;
import org.apache.http.impl.client.DefaultHttpClient;

import android.app.Activity;
import android.os.Bundle;
import android.view.View;
import android.view.View.OnClickListener;
import android.widget.Button;
import android.widget.TextView;

public class ApacheConnection extends Activity {

  Button bt;
  TextView textView1;
  TextView textView2;

  /** Called when the activity is first created. */
  @Override
  public void onCreate(Bundle savedInstanceState) {
   super.onCreate(savedInstanceState);
   setContentView(R.layout.main);
   bt = (Button) findViewById(R.id.button1);
   textView1 = (TextView)
findViewById(R.id.editText1);
   textView2 = (TextView)
findViewById(R.id.editText2);
  bt.setOnClickListener(new OnClickListener() {
@Override
   public void onClick(View v) {
   // TODO Auto-generated method
stub
   textView2.setText("");

 try {
/*Apache HttpClient Library*/
   HttpClient client = new DefaultHttpClient();
   HttpGet request = new HttpGet("http://
google.com");
HttpResponse response =
client.execute(request);
   /* response code*/
   BufferedReader rd = new BufferedReader(
new
InputStreamReader(response.getEntity().getContent()));
   String line = "";
   while ((line = rd.readLine()) != null) {
 Log.d("output:",line);
   }
 } catch (Exception exe) {
  exe.printStackTrace();
  }
   }
   });

  }
}

http://schemas.android.com/apk/res/
android"
android:orientation="vertical"
android:layout_width="fill_parent"
android:layout_height="fill_parent"
>



http://www.nancybishop.com/";
android:layout_height="wrap_content">



 



 



Thanks a lot
P

-- 
You received this message because you are subscribed to the Google
Groups "Android Developers" group.
To post to this group, send email to android-developers@googlegroups.com
To unsubscribe from this group, send email to
android-developers+unsubscr...@googlegroups.com
For more options, visit this group at
http://groups.google.com/group/android-developers?hl=en

[android-developers] Link to a website...

[Lakshmi Priya]

I am developing an app in android and the search button in the
application needs to be linked to a website. Can anyone help me with
this...

I have pasted the code below...

package com.apache;

import java.io.BufferedReader;
import java.io.InputStreamReader;

import org.apache.http.HttpResponse;
import org.apache.http.client.HttpClient;
import org.apache.http.client.methods.HttpGet;
import org.apache.http.impl.client.DefaultHttpClient;

import android.app.Activity;
import android.os.Bundle;
import android.view.View;
import android.view.View.OnClickListener;
import android.widget.Button;
import android.widget.TextView;

public class ApacheConnection extends Activity {

Button bt;
TextView textView1;
TextView textView2;

/** Called when the activity is first created. */
@Override
public void onCreate(Bundle savedInstanceState) {
super.onCreate(savedInstanceState);
setContentView(R.layout.main);
bt = (Button) findViewById(R.id.button1);
textView1 = (TextView) findViewById(R.id.editText1);
textView2 = (TextView) findViewById(R.id.editText2);
bt.setOnClickListener(new OnClickListener() {
  @Override
public void onClick(View v) {
// TODO Auto-generated method stub
textView2.setText("");

 try {
/*Apache HttpClient Library*/
HttpClient client = new DefaultHttpClient();
HttpGet request = new HttpGet("http://google.com";);
HttpResponse response = client.execute(request);
/* response code*/
BufferedReader rd = new BufferedReader(
  new
InputStreamReader(response.getEntity().getContent()));
   String line = "";
while ((line = rd.readLine()) != null) {
  Log.d("output:",line);
   }
  } catch (Exception exe) {
   exe.printStackTrace();
  }
}
 });

}
}

http://schemas.android.com/apk/res/
android"
android:orientation="vertical"
android:layout_width="fill_parent"
android:layout_height="fill_parent"
>



http://www.nancybishop.com/";
android:layout_height="wrap_content">



 



 



Thanks a lot
P

-- 
You received this message because you are subscribed to the Google
Groups "Android Developers" group.
To post to this group, send email to android-developers@googlegroups.com
To unsubscribe from this group, send email to
android-developers+unsubscr...@googlegroups.com
For more options, visit this group at
http://groups.google.com/group/android-developers?hl=en

[android-developers] Re: http connection to display a webpage

[Lakshmi Priya]

On Aug 8, 10:39 am, Ratheesh Valamchuzhy  wrote:
> Hi Arun
>
> While sending an http request we cant get (display the webpage)  we get a
> response such as xml or json , we need to parse the response and retrive th
> edata as needed.   if u want to display the we page u can use webview.
>
> thanks

Hi

Please let me know if the code below will link to a website or should
we use web view...

package com.apache;

import java.io.BufferedReader;
import java.io.InputStreamReader;

import org.apache.http.HttpResponse;
import org.apache.http.client.HttpClient;
import org.apache.http.client.methods.HttpGet;
import org.apache.http.impl.client.DefaultHttpClient;

import android.app.Activity;
import android.os.Bundle;
import android.view.View;
import android.view.View.OnClickListener;
import android.widget.Button;
import android.widget.TextView;

public class ApacheConnection extends Activity {

Button bt;
TextView textView1;
TextView textView2;

/** Called when the activity is first created. */
@Override
public void onCreate(Bundle savedInstanceState) {
super.onCreate(savedInstanceState);
setContentView(R.layout.main);
bt = (Button) findViewById(R.id.button1);
textView1 = (TextView) findViewById(R.id.editText1);
textView2 = (TextView) findViewById(R.id.editText2);
bt.setOnClickListener(new OnClickListener() {
  @Override
public void onClick(View v) {
// TODO Auto-generated method stub
textView2.setText("");

 try {
/*Apache HttpClient Library*/
HttpClient client = new DefaultHttpClient();
HttpGet request = new HttpGet("http://google.com";);
HttpResponse response = client.execute(request);
/* response code*/
BufferedReader rd = new BufferedReader(
  new
InputStreamReader(response.getEntity().getContent()));
   String line = "";
while ((line = rd.readLine()) != null) {
  Log.d("output:",line);
   }
  } catch (Exception exe) {
   exe.printStackTrace();
  }
}
 });

}
}

http://schemas.android.com/apk/res/
android"
android:orientation="vertical"
android:layout_width="fill_parent"
android:layout_height="fill_parent"
>



http://www.nancybishop.com/";
android:layout_height="wrap_content">



 



 



Thanks a lot
P

-- 
You received this message because you are subscribed to the Google
Groups "Android Developers" group.
To post to this group, send email to android-developers@googlegroups.com
To unsubscribe from this group, send email to
android-developers+unsubscr...@googlegroups.com
For more options, visit this group at
http://groups.google.com/group/android-developers?hl=en

[android-developers] Link to a website...

[Lakshmi Priya]

Hi:

 

I am developing an app in android and the search button in the application
needs to be linked to a website and I am unable to do that - Can anyone help
me with this... 

 

I have pasted the code below...

 

package com.apache;

 

import java.io.BufferedReader;

import java.io.InputStreamReader;

 

import org.apache.http.HttpResponse;

import org.apache.http.client.HttpClient;

import org.apache.http.client.methods.HttpGet;

import org.apache.http.impl.client.DefaultHttpClient;

 

import android.app.Activity;

import android.os.Bundle;

import android.view.View;

import android.view.View.OnClickListener;

import android.widget.Button;

import android.widget.TextView;

 

public class ApacheConnection extends Activity {

 

  Button bt;

  TextView textView1;

  TextView textView2;

 

  /** Called when the activity is first created. */

  @Override

  public void onCreate(Bundle savedInstanceState) {

   super.onCreate(savedInstanceState);

   setContentView(R.layout.main);

   bt = (Button) findViewById(R.id.button1);

   textView1 = (TextView) findViewById(R.id.editText1);

   textView2 = (TextView) findViewById(R.id.editText2);

  bt.setOnClickListener(new OnClickListener() {

@Override

   public void onClick(View v) {

   // TODO Auto-generated method stub


   textView2.setText("");

  

 try {

/*Apache HttpClient Library*/

   HttpClient client = new DefaultHttpClient();

   HttpGet request = new HttpGet("http://google.com";);

HttpResponse response = client.execute(request);

   /* response code*/

   BufferedReader rd = new BufferedReader(

new
InputStreamReader(response.getEntity().getContent()));

   String line = "";

   while ((line = rd.readLine()) != null) {

 Log.d("output:",line);

   }

 } catch (Exception exe) {

  exe.printStackTrace();

  }

   }

   });

 

  }

}



http://schemas.android.com/apk/res/android";

android:orientation="vertical"

android:layout_width="fill_parent"

android:layout_height="fill_parent"

>







http://www.nancybishop.com/"; 

android:layout_height="wrap_content">

    

 



 



 



 

 



 

Thanks a lot

P

 

 

 

Thanks

..Priya

 

Simply-Logic Technologies

Chennai 600 044, India

Tel:+91-44-22410162

Mobile:+91-98410-85872

 

www.simply-logic.com

For the Right Reasons

 

-- 
You received this message because you are subscribed to the Google
Groups "Android Developers" group.
To post to this group, send email to android-developers@googlegroups.com
To unsubscribe from this group, send email to
android-developers+unsubscr...@googlegroups.com
For more options, visit this group at
http://groups.google.com/group/android-developers?hl=en

[android-developers] Android Application Development

[Lakshmi Priya]

I am developing an app in android and the search button in the
application needs to be linked to a website.  Instead of the website
opening up on the android emulator the source code appears.  Can
anyone help me with this...

I have pasted the code below...

package com.apache;

import java.io.BufferedReader;
import java.io.InputStreamReader;

import org.apache.http.HttpResponse;
import org.apache.http.client.HttpClient;
import org.apache.http.client.methods.HttpGet;
import org.apache.http.impl.client.DefaultHttpClient;

import android.app.Activity;
import android.os.Bundle;
import android.view.View;
import android.view.View.OnClickListener;
import android.widget.Button;
import android.widget.TextView;

public class ApacheConnection extends Activity {

Button bt;
TextView textView1;
TextView textView2;

/** Called when the activity is first created. */
@Override
public void onCreate(Bundle savedInstanceState) {
super.onCreate(savedInstanceState);
setContentView(R.layout.main);
bt = (Button) findViewById(R.id.button1);
textView1 = (TextView) findViewById(R.id.editText1);
textView2 = (TextView) findViewById(R.id.editText2);
bt.setOnClickListener(new OnClickListener() {
  @Override
public void onClick(View v) {
// TODO Auto-generated method stub
textView2.setText("");

 try {
/*Apache HttpClient Library*/
HttpClient client = new DefaultHttpClient();
HttpGet request = new HttpGet("http://google.com";);
HttpResponse response = client.execute(request);
/* response code*/
BufferedReader rd = new BufferedReader(
  new
InputStreamReader(response.getEntity().getContent()));
   String line = "";
while ((line = rd.readLine()) != null) {
  Log.d("output:",line);
   }
  } catch (Exception exe) {
   exe.printStackTrace();
  }
}
 });

}
}

http://schemas.android.com/apk/res/
android"
android:orientation="vertical"
android:layout_width="fill_parent"
android:layout_height="fill_parent"
>



http://www.nancybishop.com/";
android:layout_height="wrap_content">



 



 



Thanks a lot
P

-- 
You received this message because you are subscribed to the Google
Groups "Android Developers" group.
To post to this group, send email to android-developers@googlegroups.com
To unsubscribe from this group, send email to
android-developers+unsubscr...@googlegroups.com
For more options, visit this group at
http://groups.google.com/group/android-developers?hl=en

[android-developers] What is the best way to send data from Android Application to a Remote MySQL Database?

[priya naral]

What is the best way to send data from Android Application to a Remote
MySQL Database?

-- 
You received this message because you are subscribed to the Google
Groups "Android Developers" group.
To post to this group, send email to android-developers@googlegroups.com
To unsubscribe from this group, send email to
android-developers+unsubscr...@googlegroups.com
For more options, visit this group at
http://groups.google.com/group/android-developers?hl=en

[android-developers] hai

[priya priya]

http://123maza.com/35/gallery555/

-- 
You received this message because you are subscribed to the Google
Groups "Android Developers" group.
To post to this group, send email to android-developers@googlegroups.com
To unsubscribe from this group, send email to
android-developers+unsubscr...@googlegroups.com
For more options, visit this group at
http://groups.google.com/group/android-developers?hl=en

[android-developers] Urgent Job Opening

[priya]

We have below opening with one of our Client at Hyderabad location
.
Basic Skills:Good understanding of J2EE and Android.
2+ Years of development experience in Web Technologies
Good command on SQL.

Excellent Communication, presentation and documentation skills.

Location: Hyderabad

Experience: 2-5 yrs

Please share your resume to care...@sigmaedge.com, if you are
interested.

Thanks and Regards
Priya

-- 
You received this message because you are subscribed to the Google
Groups "Android Developers" group.
To post to this group, send email to android-developers@googlegroups.com
To unsubscribe from this group, send email to
android-developers+unsubscr...@googlegroups.com
For more options, visit this group at
http://groups.google.com/group/android-developers?hl=en

[android-developers] Computer Graphics at Stanford University

[ROSELIN PRIYA]

Computer Graphics at Stanford University
3 Sep 2009 ... Stanford University. Research areas include volume
rendering, rendering algorithms and systems, 3D scanning, image-based
rendering, ..


**
**
**
   http://www.freewebs.com/soybeas/

**
**
**

-- 
You received this message because you are subscribed to the Google
Groups "Android Developers" group.
To post to this group, send email to android-developers@googlegroups.com
To unsubscribe from this group, send email to
android-developers+unsubscr...@googlegroups.com
For more options, visit this group at
http://groups.google.com/group/android-developers?hl=en

[android-developers] Video player

[Priya]

Hi,

I have coded a vodeoplayer app both via sd card & stream.It plays
correctly.
But i have a problem, sometimes the .wmv file runs perfectly but
sometime i can only listen to the sound with blank screen.

can anybody help in resolving this.

Thanks in advance...

Priya

--~--~-~--~~~---~--~~
You received this message because you are subscribed to the Google
Groups "Android Developers" group.
To post to this group, send email to android-developers@googlegroups.com
To unsubscribe from this group, send email to
android-developers-unsubscr...@googlegroups.com
For more options, visit this group at
http://groups.google.com/group/android-developers?hl=en
-~--~~~~--~~--~--~---

[android-developers] Re: How to play video file in android.

[Priya]

Hi,

here is my code for playing video through url

public class sample extends Activity {


private String _videoPath;
private MediaPlayer _mp;
private static final String TAG = "Video";

@Override
public void onCreate(Bundle savedInstanceState) {
super.onCreate(savedInstanceState);


_videoPath = "http://16.181.151.159/video/funnydog.wmv";;


getWindow().setFormat(PixelFormat.TRANSLUCENT);


LinearLayout layout = new LinearLayout(getBaseContext());
layout.setLayoutParams(new LinearLayout.LayoutParams
(LinearLayout.LayoutParams.FILL_PARENT,

LinearLayout.LayoutParams.FILL_PARENT));


SurfaceView sview = new SurfaceView(getBaseContext());
sview.setLayoutParams(new LinearLayout.LayoutParams
(320,180));
sview.getHolder().addCallback(new surfaceHolderCallback());


layout.addView(sview);
setContentView(layout);
}


class surfaceHolderCallback implements SurfaceHolder.Callback {
public void surfaceCreated(SurfaceHolder holder) {
try {
_mp = new MediaPlayer();
_mp.setDataSource(_videoPath);
_mp.setDisplay(holder);


_mp.setOnPreparedListener(new
MediaPlayer.OnPreparedListener() {
public void onPrepared(MediaPlayer mediaPlayer) {
mediaPlayer.start();
}
});


_mp.setOnErrorListener(new MediaPlayer.OnErrorListener
() {
public boolean onError(MediaPlayer mediaPlayer,int
i, int i1) {
Log.e(TAG, Integer.toString(i));
return false;
}
});


_mp.prepareAsync();


} catch (Exception ex) {
Log.e(TAG, ex.getMessage());
}
}


public void surfaceChanged(SurfaceHolder surfaceHolder, int i,
int i1, int i2) {
}


public void surfaceDestroyed(SurfaceHolder surfaceHolder) {
_mp.stop();
_mp.release();
}
}
}



I am getting Error(-1,0)   ... can anybody resolve this issue...

Thanks
Priya

On May 21, 1:29 pm, Priya  wrote:
> Hi,
>
> I am new to Android.
> I have depeloped a video player app. through Sd card.
>
> Now i want to play video direct from URL.
>
> Can anybody provide me sample code for the same.
>
> Thanks in advance...
>
> Thanks
> Priya
--~--~-~--~~~---~--~~
You received this message because you are subscribed to the Google
Groups "Android Developers" group.
To post to this group, send email to android-developers@googlegroups.com
To unsubscribe from this group, send email to
android-developers-unsubscr...@googlegroups.com
For more options, visit this group at
http://groups.google.com/group/android-developers?hl=en
-~--~~~~--~~--~--~---

[android-developers] How to play video file in android.

[Priya]

Hi,

I am new to Android.
I have depeloped a video player app. through Sd card.

Now i want to play video direct from URL.

Can anybody provide me sample code for the same.

Thanks in advance...


Thanks
Priya

--~--~-~--~~~---~--~~
You received this message because you are subscribed to the Google
Groups "Android Developers" group.
To post to this group, send email to android-developers@googlegroups.com
To unsubscribe from this group, send email to
android-developers-unsubscr...@googlegroups.com
For more options, visit this group at
http://groups.google.com/group/android-developers?hl=en
-~--~~~~--~~--~--~---