On 3/26/2012 10:25 PM, Shawn Heisey wrote:
The problem is that I currently have no way (that I know of so far) to
detect that a problem happened. As far as my code is concerned,
everything worked, so it updates my position tracking and those
documents will never be inserted. I have not yet de
Hi,
Actually we ran into the same issue with using ids parameter, in the solr
front with shards architecture (exception throws in the solr front). Were
you able to solve it by using the key:value syntax or some other way?
BTW, there was a related issue:
https://issues.apache.org/jira/browse/SOLR-
I can't find better examples at the moment... I hope they are sufficient to
describe what I need.
''' Code
25 01 RETURN-CODES.
26 05 RTC00 PIC X(2) VALUE '00'.
27 05 RTC01 PIC X(2) VALUE '01'.
28 05 RTC04 PIC X(2) VALUE '04'.
29 05 RTC08 PIC X(2) VALUE '08'.
''' /Code
This
Hi,
I am using DIH to index local file system. But the file path, size and
lastmodified field were not stored. in the schema.xml I defined:
And also defined tika-data-config.xml:
What type of logging were you using?
Did you try log back? We get a pretty large increase when using that.
On Fri, Mar 23, 2012 at 2:57 PM, dw5ight wrote:
> Hey All-
>
> we run a http://carsabi.com car search engine with Solr and did some
> benchmarking recently after we switched from a hosted
On 3/26/2012 6:43 PM, Mark Miller wrote:
It doesn't get thrown because that logic needs to continue - you don't
necessarily want one bad document to stop all the following documents from
being added. So the exception is sent to that method with the idea that you can
override and do what you wo
yes ,I must have mis-copied and yes, i do have the conf folder per core
with schema etc ...
Because of this issue ,we have decided to have multiple webapps with about
50 cores per webapp ,instead of one singe webapp with all 200 cores ,would
this make better sense ?
what would be your suggestion
all of my highlights has one character mistake in the offset,some fragments
from my response. Thanks!
0
259
on
sequence
true
10
2.2
*,score
true
0
sequence:NGNFN
TSQSELSNGNFNRRPKIELSNFDGNHPKTWIRKC
GENTRERNGNFNSLTRERSFAELENHPPKVRRNGSEG
EGRYPCNNGNFNLTTGRCVCEKNYVHLIYEDRI
YAEE
all of my highlights has one character mistake in the offset,some fragments
from my response. Thanks!
0
259
on
sequence
true
10
2.2
*,score
true
0
sequence:NGNFN
TSQSELSNGNFNRRPKIELSNFDGNHPKTWIRKC
GENTRERNGNFNSLTRERSFAELENHPPKVRRNGSEG
EGRYPCNNGNFNLTTGRCVCEKNYVHLIYEDRI
YAEEN
For whatever reason. I'm having difficult ulty reproducing the issue, I'll
continue to try and reproduce
On Sunday, March 25, 2012, Mark Miller wrote:
> Yeah, sorry - that's what I meant.
>
> Sent from my iPad
>
> On Mar 24, 2012, at 2:18 PM, Jamie Johnson wrote:
>
>> There is no stack trace, I
It doesn't get thrown because that logic needs to continue - you don't
necessarily want one bad document to stop all the following documents from
being added. So the exception is sent to that method with the idea that you can
override and do what you would like. I've written sample code around s
I've been building a new version of my app that keeps our Solr indexes
up to date. I had hoped to use StreamingUpdateSolrServer instead of
CommonsHttpSolrServer for performance reasons, but I have run into a
showstopper problem that has made me revert to CHSS.
I have been relying on exception
Erick,
I haven't changed the maxCommitsToKeep yet.
We stopped the slave that had issues and removed the data dir as you
pointed and afer starting it, everything started working as normal.
I guess that at some point someone commited on the slave or even copied the
master files over and made this me
I've filed an issue for myself as a reminder. Guava r05 is pretty old
indeed, time to upgrade.
S.
On Mon, Mar 26, 2012 at 23:12, Nicholas Ball wrote:
>
> Hey Staszek,
>
> Thanks for the reply. Yep using 4.x and that was exactly what I ended up
> doing, a quick replace :)
> Just thought I'd docum
Hey Staszek,
Thanks for the reply. Yep using 4.x and that was exactly what I ended up
doing, a quick replace :)
Just thought I'd document it somewhere for a proper fix to be done in the
4.0 release.
No issues arose for me but then again Erick mentions it's only used in
Carrot2 contrib which I'm
Hi Nick,
Which version of Solr do you have in mind? The official 3.x line or 4.0?
The quick and dirty fix to try would be to just replace Guava r05 with the
latest version, chances are it will work (we did that in the past though
the version number difference was smaller).
The proper fix would b
Consider writing a SolrJ program that extracts the data from the
PDF file and combines it with the XML data. Here's an example
to get you started, it shows how to do the PDF extraction at least.
The other part of the code is a database connection, ignore that part.
You'll have to read in the XML,
Hey,
I am making an image search engine where people can tag images with various
items that are themselves tagged.
For example, http://example.com/abc.jpg is tagged with the following three
items:
- item1 that is tagged with: tall blond woman
- item2 that is tagged with: yellow purse
- item3 that
Shouldn't be. What do your log files say? You have to treat each
core as a separate index. In other words, you need to have a core#/conf
with the schema matching your core#/data/index directory etc.
I suspect you've simply mis-copied something.
Best
Erick
On Mon, Mar 26, 2012 at 8:27 AM, Sujatha
trying to play with javascript to clean-up my URL!!
Context is velocity
Suggestions?
Thanks
--
View this message in context:
http://lucene.472066.n3.nabble.com/First-steps-with-Solr-tp3858406p3858959.html
Sent from the Solr - User mailing list archive at Nabble.com.
Did you try
http://lucene.apache.org/solr/api/org/apache/solr/client/solrj/impl/LBHttpSolrServer.html?
This might be what you're looking for.
On Mon, Mar 26, 2012 at 11:23 AM, wrote:
> Hi,
>
> has SolrJ any possiblities to do a failover from a master to a slave for
> searching?
>
> Thank you
>
Partially solved problem!
I am playing with the doc.vm file in the velocity folder.
I have replaced
where access is the value or the URL I want.
problem is that someone seems to insert spaces (%20) between *
Chausey? and #field('access') resulting into an invalid query. Everthing
else seems O
Partially solved problem!
I am playing with the doc.vm file in the velocity folder.
I have replaced
*#field('name')*
by
* http://127.0.0.1:2317/Chausey?#field('access') #field('name') *
where access is the value or the URL I want.
problem is that someone seems to insert spaces (%20) between *
Hi
A noobie question. I am uncertain what is the best way to design for my
requirement which the following.
I want to allow another client in solrj to query solr with a query that is
handled with a custom handler
localhost:9090/solr/tokenSearch?tokens{!dismax
qf=content}pear,apples,oyster,kin
Hi,
has SolrJ any possiblities to do a failover from a master to a slave for
searching?
Thank you
Hi, I have been exploring Solr through the example provided.
I have created my own set of documents, and can start to index and query
using the Solritas GUI.
Two questions:
1/ I would like to have the "name" field to contain a URL to another server
on my machine.
When I put " text " inside t
https://issues.apache.org/jira/browse/SOLR-3275 is the ticket I
created. If it's not clear enough please let me know I can try to
elaborate.
On Mon, Mar 26, 2012 at 3:46 AM, Stefan Matheis
wrote:
> Jamie: SOLR-3238 is the current admin-ticket. create a new one for the
> cloud-related options an
Hi,
We have a requirement to facet on a field with a date value so that the
following buckets are shown:
a) Last Week
b) Last Month
c) Last Year
d) 2012
e) 2011 or earlier
Of course, as 2013 rolls in, then the labels for the last two buckets
should change to “
That's great information.
Thanks for all the help and guidance, its been invaluable.
Thanks
Ben
-Original Message-
From: Erick Erickson [mailto:erickerick...@gmail.com]
Sent: 26 March 2012 12:21
To: solr-user@lucene.apache.org
Subject: Re: Simple Slave Replication Question
It's the opti
Check out solr/contrib/analysis-extras/build.xml
-Original Message-
From: Lance Norskog [mailto:goks...@gmail.com]
Sent: Monday, March 26, 2012 2:14 AM
To: solr-user@lucene.apache.org
Subject: Re: "ant test" and contribs
Ah! It is more complex. There is code and a library jar in
lucene/
I was migrating to cores from webapp ,and I was copying a bunch of indexes
from webapps to respective cores ,when I restarted ,I had this issue where
the whole webapp with the cores would not startup and was getting index
corrupted message..
In this scenario or in a scenario where there is an issu
Your problem is the KeywordTokenizerFactory and the query parser.
This often trips people up. When you use author:(stephen king), the
query parser breaks this up before it gets to the analysis chain
into two separate tokens. But by virtue of the
fact that you're using KeywordTokenizer, the actual f
It's the optimize step. Optimize essentially forces all the segments to
be copied into a single new segment, which means that your entire index
will be replicated to the slaves.
In recent Solrs, there's usually no need to optimize, so unless and until you
can demonstrate a noticeable change, I'd j
Index corruption is very rare, can you provide more details how you
got into that state?
Best
Erick
On Sun, Mar 25, 2012 at 1:22 PM, Sujatha Arun wrote:
> Hello,
>
> Suppose I have several cores in a single webapp ,I have issue with Index
> beong corrupted in one core ,or schema /solrconfig of
Depending upon what you actually need to do, you could consider just
attaching to the running Solr instance remotely. I know it's easy in
IntelliJ, and believe Eclipse makes this easy as well but I haven't
used Eclipse in a while
Best
Erick
On Sat, Mar 24, 2012 at 11:11 PM, Li Li wrote:
> I
I have created my own field type. I have indexed "Stephen King" and
get no hit when searching
author:(stephen king)
I get a hit when searching like this
author:(stephen* AND *king)
I also get a hit when searching like this
author:"stephen king"
So it seems like when querying with (...) it actual
Hmmm, near as I can tell, guava is only used in the Carrot2 contrib, so maybe
ask over at: http://project.carrot2.org/?
Best
Erick
On Sat, Mar 24, 2012 at 3:31 PM, Nicholas Ball
wrote:
>
> Hey all,
>
> Working on a plugin, which uses the Curator library (ZooKeeper client).
> Curator depends on t
Hi Bastian,
Can you please tell us what kind of search you imagine doing with some (use
case) examples?
Marcelo
On Monday, March 26, 2012, Bastian H wrote:
> Hi,
>
> I like to index my Source Code - the most is Cobol, Asembler and Java -
> with Solr.
>
> I don't know where to start... I think I
Thanks, this is very helpful!
On Sat, Mar 24, 2012 at 4:50 AM, Martin Koch wrote:
> Thanks for writing this up. These are good tips.
>
> /Martin
>
> On Fri, Mar 23, 2012 at 9:57 PM, dw5ight wrote:
>
>> Hey All-
>>
>> we run a http://carsabi.com car search engine with Solr and did some
>> bench
Hi,
I like to index my Source Code - the most is Cobol, Asembler and Java -
with Solr.
I don't know where to start... I think I need to parse it to get XML for
Solr. Do I need Tinka? Is there any Parser I could use?
I want to index functions, variables and function calls as well as
commentaries.
Hello,
Had to leave the office so didn't get a chance to reply. Nothing in the logs.
Just ran one through from the ingest tool.
Same results full copy of the index.
Is it something to do with:
server.commit();
server.optimize();
I call this at the end of the ingestion.
Would optimize then
Jamie: SOLR-3238 is the current admin-ticket. create a new one for the
cloud-related options and describe what (and where) you'd like to have :)
On Sunday, March 25, 2012 at 4:25 AM, Jamie Johnson wrote:
> Is there a plan to add the ability to specify the shard and
> collection when adding a c
42 matches
Mail list logo