Dear Group
I'm using peptideSieve v0.51 (windows version with GUI) in order to
predict the likelyhood that some proteins of interest can be seen in a
proteomic experiment.
The problem is that some proteins are completely not present in the
output even if teorically they could be cleaved by trypsin(I tryed
with peptidecutter software).
This in my opinion is strange, because for the peptides obtained by in
silico digestion, I should obtain a value  of their likelyhood...
I'm not considering anything?
Thank you very much for any help you could give to me

Below  I paste one of the sequences for which I don't find any peptide
in the output
As parameters I select:
 all the experimental design,
peptide length 3-50
missed cleavage 1
threshold score  0



MAQGTLIRVTPEQPTHAVCVLGTLTQLDICSSAPEDCTSFSINASPGVVVDIAHGPPAKK

KSTGSSTWPLDPGVEVTLTMKVASGSTGDQKVQISYYGPKTPPVKALLYLTGVDGVSPCH

PGWSAMA

-- 
You received this message because you are subscribed to the Google Groups 
"spctools-discuss" group.
To post to this group, send email to [email protected].
To unsubscribe from this group, send email to 
[email protected].
For more options, visit this group at 
http://groups.google.com/group/spctools-discuss?hl=en.

Reply via email to