Dear all,

I have recently generated an in-silico spectral library for several 
peptides which may contains different modifications on the same cystein 
(cystein converted to a serin, formylglycin-aldehyde, ...). For this 
prediction I used Seq2MS 
(https://pubs.acs.org/doi/10.1021/acs.jproteome.3c00180) and obtained a 
library in msp format.
In this file the header indicates modifications for examle in the following 
way:

Name: DILTPELDNLAQNGSIFTSAYVAHPFCGPSR/2_1(26,C,FGAldehyd)
Comment: Charge=2 Parent=1657.310386 Mods=1(26,C,FGAldehyd) Protein=nan

If I correctly specify the modifications in a .usermods file(*) and import 
it to spectraST, the resulting sptxt files contain header such as:

Name: DILTPELDNLAQNGSIFTSAYVAHPFC[85]GPSR/2
LibID: 6
MW: 3316.6353
PrecursorMZ: 1658.3177
Status: Normal
FullName: X.DILTPELDNLAQNGSIFTSAYVAHPFC[85]GPSR.X/2 (CID)
Comment: AvePrecursorMz=1659.3531 BinaryFileOffset=19516 Charge=2 
FracUnassigned=0.89,4/5;0.83,16/20;0.56,35/60 Mods=1(26,C,FGAldehyd) NAA=31 
NISTProtein=nan NMC=0 NTT=1 Parent=1657.310386 Prob=1.0000 Protein=1/nan

However, when I want to check the spectra in this file in HTML format using 
Lib2HTML, the table contains the complete peptide only for the unmodified 
form and has an identical truncated peptide for all other modified forms:

[image: Unbenannt.PNG]

Ths does not only affect the truncated amino acids but also results in 
mis-alignment of the y-ion-series (i.e. due to the modified cystein, y1 is 
annotated as 122.027 while in this case it should be y5 with a much larger 
m/z). Again, the annotation in sptxt seems good.

Does anyone has an idea how to solve this and/or how I could watch the 
spectra alternatively?

Best,
Juergen


(*) part of the usermods file:
C[se]|-15.977156|Serin
C[al]|-17.992806|FGAldehyd
...

-- 
You received this message because you are subscribed to the Google Groups 
"spctools-discuss" group.
To unsubscribe from this group and stop receiving emails from it, send an email 
to [email protected].
To view this discussion on the web visit 
https://groups.google.com/d/msgid/spctools-discuss/c568f446-b522-40fe-8e03-27684fd71d1bn%40googlegroups.com.

Reply via email to