Excellent! Thank you for letting me know.

> On Apr 11, 2024, at 9:12 AM, 'Juergen Bartel' via spctools-discuss 
> <[email protected]> wrote:
> 
> Hi David,
> 
> Thank you for modifying the code so quickly! I have just tested Lib2HTML with 
> the new prerelease and it works perfectly fine now.
> 
> Cheers!
> Juergen
> 
> David Shteynberg schrieb am Donnerstag, 11. April 2024 um 02:28:19 UTC+2:
>> Hello Juergen,
>> 
>> Thanks for providing the test data.  I was able to modify the code to allow 
>> Lib2HTML to also read the user modifications and display the from the HTML 
>> page.  The prerelease installer that has this feature is available here:  
>> 
>> https://sourceforge.net/projects/sashimi/files/Trans-Proteomic%20Pipeline%20%28TPP%29/TPP%20v7.0%20%28Arafel%29%20rev%20X/TPP_Setup_7.0.x.exe/download
>> 
>> Let me know if you have any other questions.
>> 
>> Cheers!
>> -David
>> 
>> T
>> 
>> On Fri, Apr 5, 2024 at 1:45 AM 'Juergen Bartel' via spctools-discuss 
>> <[email protected] <>> wrote:
>>> Dear David,
>>> 
>>> to generate my library I have done a couple of steps:
>>> 1) modified the file utils.py from seq2ms to contain my modifications:
>>> # C H N O S P
>>> # mods = {"ox" : [0,0,0,1,0,0], ## changed this line to enable sulfatase 
>>> modification prediction se=serine; al=formylglycine-aldehyd; 
>>> do=formylglycine-diol; ds=diol-sulfate; ss=serine-sulfate
>>> mods = {"ox" : [0,0,0,1,0,0], "se" : [0,0,1,0,-1,0], "al" : 
>>> [0,-2,1,0,-1,0], "do" : [0,0,2,0,-1,0], "ds" : [0,-1,5,0,0,0], "ss" : 
>>> [0,0,4,0,0,0],
>>>         "ph" : [0,1,0,3,0,1], 
>>>         "cam" : [2,3,1,1,0,0] , "ac": [2,2,0,1,0,0], "me": [1,2,0,0,0,0], 
>>> "hy": [0,0,0,1,0,0], "gly": [4,6,2,2,0,0],
>>>         "bi" : [10,14,2,2,1,0], "cr": [4,4,0,1,0,0], "di": [2,4,0,0,0,0], 
>>> "ma": [3,2,0,3,0,0], "ni": [0,-1,1,2,0,0],
>>>         "bu" : [4,6,0,1,0,0], "fo": [1,0,0,1,0,0], "glu": [5,6,0,3,0,0], 
>>> "hyb": [4,6,0,2,0,0], "pr": [3,4,0,1,0,0],
>>>         "su" : [4,4,0,3,0,0], "tr": [3,6,0,0,0,0], "ci": [0,-1,-1,1,0,0]}
>>> 
>>> 2) I run the prediction by executing 'predict.py' with the a modified 
>>> input.tsv and (I think) the pretrained_model. The input file looked like 
>>> the following but contained more peptides:
>>> Sequence    Charge  Mass    Modified sequence       Modification    Protein
>>> DILTPELDNLAQNGSIFTSAYVAHPFCGPSR     2       3332.613578     
>>> _DILTPELDNLAQNGSIFTSAYVAHPFCGPSR_       Unmodified      
>>> DILTPELDNLAQNGSIFTSAYVAHPFCGPSR     3       3332.613576     
>>> _DILTPELDNLAQNGSIFTSAYVAHPFCGPSR_       Unmodified      
>>> DILTPELDNLAQNGSIFTSAYVAHPFCGPSR     4       3332.613576     
>>> _DILTPELDNLAQNGSIFTSAYVAHPFCGPSR_       Unmodified      
>>> DILTPELDNLAQNGSIFTSAYVAHPFCGPSR     2       3316.636422     
>>> _DILTPELDNLAQNGSIFTSAYVAHPFC(se)GPSR_   Serine (C)      
>>> DILTPELDNLAQNGSIFTSAYVAHPFCGPSR     3       3316.636422     
>>> _DILTPELDNLAQNGSIFTSAYVAHPFC(se)GPSR_   Serine (C)      
>>> DILTPELDNLAQNGSIFTSAYVAHPFCGPSR     4       3316.63642      
>>> _DILTPELDNLAQNGSIFTSAYVAHPFC(se)GPSR_   Serine (C)      
>>> DILTPELDNLAQNGSIFTSAYVAHPFCGPSR     2       3314.620772     
>>> _DILTPELDNLAQNGSIFTSAYVAHPFC(al)GPSR_   FGAldehyd (C)   
>>> DILTPELDNLAQNGSIFTSAYVAHPFCGPSR     3       3314.62077      
>>> _DILTPELDNLAQNGSIFTSAYVAHPFC(al)GPSR_   FGAldehyd (C)   
>>> DILTPELDNLAQNGSIFTSAYVAHPFCGPSR     4       3314.620772     
>>> _DILTPELDNLAQNGSIFTSAYVAHPFC(al)GPSR_   FGAldehyd (C)   
>>> DILTPELDNLAQNGSIFTSAYVAHPFCGPSR     2       3332.631336     
>>> _DILTPELDNLAQNGSIFTSAYVAHPFC(do)GPSR_   FGDiol (C)      
>>> DILTPELDNLAQNGSIFTSAYVAHPFCGPSR     3       3332.631336     
>>> _DILTPELDNLAQNGSIFTSAYVAHPFC(do)GPSR_   FGDiol (C)      
>>> DILTPELDNLAQNGSIFTSAYVAHPFCGPSR     4       3332.631336     
>>> _DILTPELDNLAQNGSIFTSAYVAHPFC(do)GPSR_   FGDiol (C)      
>>> DILTPELDNLAQNGSIFTSAYVAHPFCGPSR     2       3411.580326     
>>> _DILTPELDNLAQNGSIFTSAYVAHPFC(ds)GPSR_   DiolSulfat (C)  
>>> DILTPELDNLAQNGSIFTSAYVAHPFCGPSR     3       3411.580326     
>>> _DILTPELDNLAQNGSIFTSAYVAHPFC(ds)GPSR_   DiolSulfat (C)  
>>> DILTPELDNLAQNGSIFTSAYVAHPFCGPSR     4       3411.580324     
>>> _DILTPELDNLAQNGSIFTSAYVAHPFC(ds)GPSR_   DiolSulfat (C)  
>>> DILTPELDNLAQNGSIFTSAYVAHPFCGPSR     2       3396.593236     
>>> _DILTPELDNLAQNGSIFTSAYVAHPFC(ss)GPSR_   SerinSulfat (C) 
>>> DILTPELDNLAQNGSIFTSAYVAHPFCGPSR     3       3396.593235     
>>> _DILTPELDNLAQNGSIFTSAYVAHPFC(ss)GPSR_   Unmodified      
>>> DILTPELDNLAQNGSIFTSAYVAHPFCGPSR     4       3396.593236     
>>> _DILTPELDNLAQNGSIFTSAYVAHPFC(ss)GPSR_   Unmodified      
>>> 
>>> 3) I imported the generated .msp file into spectraST format using the 
>>> command line and the following options:
>>> C:\TPP\bin\spectrast.exe -cNPredicted_Sec2MS.splib -MSec2MS.usermods 
>>> Predicted.msp
>>> 
>>> 4) I tried to visualise this library by Lib2HTML from the within Petunia
>>> 
>>> For the files I will send you a link via the ISB contact form to our 
>>> university's nextcloud where I have uploaded them.
>>> 
>>> Best regards,
>>> Juergen
>>> 
>>> 
>>> Juergen Bartel schrieb am Montag, 22. Januar 2024 um 18:22:49 UTC+1:
>>>> Dear all,
>>>> 
>>>> I have recently generated an in-silico spectral library for several 
>>>> peptides which may contains different modifications on the same cystein 
>>>> (cystein converted to a serin, formylglycin-aldehyde, ...). For this 
>>>> prediction I used Seq2MS 
>>>> (https://pubs.acs.org/doi/10.1021/acs.jproteome.3c00180) and obtained a 
>>>> library in msp format.
>>>> In this file the header indicates modifications for examle in the 
>>>> following way:
>>>> 
>>>> Name: DILTPELDNLAQNGSIFTSAYVAHPFCGPSR/2_1(26,C,FGAldehyd)
>>>> Comment: Charge=2 Parent=1657.310386 Mods=1(26,C,FGAldehyd) Protein=nan
>>>> 
>>>> If I correctly specify the modifications in a .usermods file(*) and import 
>>>> it to spectraST, the resulting sptxt files contain header such as:
>>>> 
>>>> Name: DILTPELDNLAQNGSIFTSAYVAHPFC[85]GPSR/2
>>>> LibID: 6
>>>> MW: 3316.6353
>>>> PrecursorMZ: 1658.3177
>>>> Status: Normal
>>>> FullName: X.DILTPELDNLAQNGSIFTSAYVAHPFC[85]GPSR.X/2 (CID)
>>>> Comment: AvePrecursorMz=1659.3531 BinaryFileOffset=19516 Charge=2 
>>>> FracUnassigned=0.89,4/5;0.83,16/20;0.56,35/60 Mods=1(26,C,FGAldehyd) 
>>>> NAA=31 NISTProtein=nan NMC=0 NTT=1 Parent=1657.310386 Prob=1.0000 
>>>> Protein=1/nan
>>>> 
>>>> However, when I want to check the spectra in this file in HTML format 
>>>> using Lib2HTML, the table contains the complete peptide only for the 
>>>> unmodified form and has an identical truncated peptide for all other 
>>>> modified forms:
>>>> 
>>>> 
>>>> 
>>>> Ths does not only affect the truncated amino acids but also results in 
>>>> mis-alignment of the y-ion-series (i.e. due to the modified cystein, y1 is 
>>>> annotated as 122.027 while in this case it should be y5 with a much larger 
>>>> m/z). Again, the annotation in sptxt seems good.
>>>> 
>>>> Does anyone has an idea how to solve this and/or how I could watch the 
>>>> spectra alternatively?
>>>> 
>>>> Best,
>>>> Juergen
>>>> 
>>>> 
>>>> (*) part of the usermods file:
>>>> C[se]|-15.977156|Serin
>>>> C[al]|-17.992806|FGAldehyd
>>>> ...
>>> 
>>> 
>> 
>>> -- 
>>> You received this message because you are subscribed to the Google Groups 
>>> "spctools-discuss" group.
>>> To unsubscribe from this group and stop receiving emails from it, send an 
>>> email to [email protected] <>.
>>> To view this discussion on the web visit 
>>> https://groups.google.com/d/msgid/spctools-discuss/dd0ac502-dde9-495c-ac48-58340707b5b9n%40googlegroups.com
>>>  
>>> <https://groups.google.com/d/msgid/spctools-discuss/dd0ac502-dde9-495c-ac48-58340707b5b9n%40googlegroups.com?utm_medium=email&utm_source=footer>.
> 
> 
> -- 
> You received this message because you are subscribed to the Google Groups 
> "spctools-discuss" group.
> To unsubscribe from this group and stop receiving emails from it, send an 
> email to [email protected] 
> <mailto:[email protected]>.
> To view this discussion on the web visit 
> https://groups.google.com/d/msgid/spctools-discuss/9cae6f2c-dc06-4545-a998-ea33424703aan%40googlegroups.com
>  
> <https://groups.google.com/d/msgid/spctools-discuss/9cae6f2c-dc06-4545-a998-ea33424703aan%40googlegroups.com?utm_medium=email&utm_source=footer>.

-- 
You received this message because you are subscribed to the Google Groups 
"spctools-discuss" group.
To unsubscribe from this group and stop receiving emails from it, send an email 
to [email protected].
To view this discussion on the web visit 
https://groups.google.com/d/msgid/spctools-discuss/25AD706B-4054-433D-A5C0-1686122D5956%40systemsbiology.org.

Reply via email to