Le 14/10/2010 18:46, Raphaël Flores a écrit :
Hi dear all.
I'm on to upgrading to T2.2 from T1.7.2. In older version, I used
"EBI_PICR_Sequence_to_UniParc_and_InterPro
<http://www.myexperiment.org/workflows/235.html>" workflow without any
problem. I'm not able to make it running correctly in T2.2, the
difference seems to be in parameters sent to 'getUPIForSequence'
webservice.
In taverna 1.7.2 it was:
<parameters
xmlns="http://www.ebi.ac.uk/picr/AccessionMappingService";><sequence>>Swiss-Prot|P24631
MDGRMFGLETPLMVALQHLLDVPDGDAGAGGDKAGGGGPTRTYVADARAMAVTPADVKELPGAYAFVVDMPGLGTGDIKVQVEDERVLVISGERRREEREDAKYLRMERRMGKFMRKFVLPDNADMDKISAVCRDGVLTVTVEKLPPPEPKKPKTIEVKVA</sequence></parameters>
In taverna 2.2, it is:
<parameters
xmlns="http://www.ebi.ac.uk/picr/AccessionMappingService";><sequence>>Swiss-Prot|P24631
MDGRMFGLETPLMVALQHLLDVPDGDAGAGGDKAGGGGPTRTYVADARAMAVTPADVKELPGAYAFVVDMPGLGTGDIKVQVEDERVLVISGERRREEREDAKYLRMERRMGKFMRKFVLPDNADMDKISAVCRDGVLTVTVEKLPPPEPKKPKTIEVKVA</sequence><searchDatabases></searchDatabases><taxonId></taxonId><onlyActive></onlyActive></parameters>
Empty parameters are sent, and apparently the webservice is not able
to process them correctly, result is empty - while T1.7.2 succeeded
(cf attached result file):
<getUPIForSequenceReturn />
Is this a known issue?
Is it possible to make the workflow running by deleting parameters
from 'PICR_input_params' in Taverna? I took a look, but did not find
how to do so.
Thanks for help.
Regards.
Hi,
I solved my problem by adding some default values (list of databases,
-1, true) to parameters. My question concerning parameters deletion remains.
Regards.
--
Raphaël Flores
Téléphone : 01 69 33 23 56
UMR de Génétique Végétale, INRA, Univ. Paris-Sud, CNRS, AgroParisTech,
F-91190 Gif-sur-Yvette, France
------------------------------------------------------------------------------
Download new Adobe(R) Flash(R) Builder(TM) 4
The new Adobe(R) Flex(R) 4 and Flash(R) Builder(TM) 4 (formerly
Flex(R) Builder(TM)) enable the development of rich applications that run
across multiple browsers and platforms. Download your free trials today!
http://p.sf.net/sfu/adobe-dev2dev
_______________________________________________
taverna-users mailing list
[email protected]
[email protected]
Web site: http://www.taverna.org.uk
Mailing lists: http://www.taverna.org.uk/about/contact-us/
