2010/10/14 Raphaël Flores <[email protected]>: > In taverna 2.2, it is: > <parameters > xmlns="http://www.ebi.ac.uk/picr/AccessionMappingService";><sequence>>Swiss-Prot|P24631 > MDGRMFGLETPLMVALQHLLDVPDGDAGAGGDKAGGGGPTRTYVADARAMAVTPADVKELPGAYAFVVDMPGLGTGDIKVQVEDERVLVISGERRREEREDAKYLRMERRMGKFMRKFVLPDNADMDKISAVCRDGVLTVTVEKLPPPEPKKPKTIEVKVA</sequence><searchDatabases></searchDatabases><taxonId></taxonId><onlyActive></onlyActive></parameters> > > Empty parameters are sent, and apparently the webservice is not able to > process them correctly, result is empty - while T1.7.2 succeeded (cf > attached result file): > <getUPIForSequenceReturn />
The WSDL at http://www.ebi.ac.uk/Tools/picr/service?wsdl says: <element name="getUPIForSequence"> <complexType> <sequence> <element name="sequence" type="xsd:string"></element> <element maxOccurs="unbounded" name="searchDatabases" type="xsd:string"></element> <element name="taxonId" type="xsd:string"></element> <element name="onlyActive" type="xsd:boolean"></element> </sequence> </complexType> </element> which means that the elements are all required (for searchDatabases you can have 1 or more) - so we are forced to send them all. (I'm not sure why Taverna 1.7.2 didn't - that sounds like a bug). As the elements are not nillable, we insert the empty string as the value. We did have a bug before 2.2.0 that we did not always honour minOccurs="0" for optional elements - http://www.mygrid.org.uk/dev/issues/browse/T2-847 - but in this case the elements are not declared optional. If the service genuinely accepts calls missing some of these elements, and treating that as a selection of defaults - then the WSDL should be updated to reflect this. You could contact the service provider EBI about this. See http://www.ebi.ac.uk/Tools/picr/ for details. -- Stian Soiland-Reyes, myGrid team School of Computer Science The University of Manchester ------------------------------------------------------------------------------ Download new Adobe(R) Flash(R) Builder(TM) 4 The new Adobe(R) Flex(R) 4 and Flash(R) Builder(TM) 4 (formerly Flex(R) Builder(TM)) enable the development of rich applications that run across multiple browsers and platforms. Download your free trials today! http://p.sf.net/sfu/adobe-dev2dev _______________________________________________ taverna-users mailing list [email protected] [email protected] Web site: http://www.taverna.org.uk Mailing lists: http://www.taverna.org.uk/about/contact-us/
