Hi, Martin!

This does seem to be a bug in the PSL customTrack loader.
It should mark the strand as "-" instead of "+".
We will look into it.

Currently we convert PSL custom tracks to bed12.
So it really can't show un-aligned parts.

The BLAT track (hgBlat) does a much better job
of showing more details about the alignment.

Thank you for reporting the problem.

-Galt

10/18/2010 7:05 PM, Martin Frith:
> Dear genome folks,
>
> I would like to display a custom track of protein-versus-genome
> alignments.  I tried using PSL format, but there seems to be a bug
> with "-" strands.
>
> For example, I blatted this sequence against hg19 with "output type"
> set to hyperlink:
> LSVADHAPQFAVPSDTATAPQAESVLRPLYMDVQATTPL
>
> The output looks like this:
> SCORE START  END QSIZE IDENTITY CHRO STRAND  START    END      SPAN
>    63     1    39    39  77.0%    20  +-   34286403  34286519    117
> When I view it in the browser, the arrows go right-to-left, which is
> correct.
>
> I repeated this blat with "output type" set to psl:
> match mis-  rep.        N's     Q gap   Q gap   T gap   T gap   strand  ...
>        match match               count   bases   count   bases           ...
> 30    9     0           0       0       0       0       0       +-      ...
> I then pasted this PSL line into "add custom tracks".
> When I view it in the browser, the arrows go left-to-right, which
> seems wrong.
>
>
> By the way, can I / should I use any format other than PSL for a
> custom track of translated alignments?  I tried MAF, but it didn't
> work.  It would be nice if I could click on a track item and see the
> alignment.  It would be nice if stop codons and frameshifts were
> highlighted in red or something, is it possible to do that?
>
> Have a nice day,
> Martin Frith
> http://www.cbrc.jp/~martin/
> _______________________________________________
> Genome maillist  -  [email protected]
> https://lists.soe.ucsc.edu/mailman/listinfo/genome

_______________________________________________
Genome maillist  -  [email protected]
https://lists.soe.ucsc.edu/mailman/listinfo/genome

Reply via email to