Hi Angie and Galt,

many thanks for your informative replies.

> Did MAF not work for you because it is a nucleotide-level format, or
> some other reason?

It seems to me that MAF is a nice, general alignment format, which can
handle protein-level alignments too.  For example:

track name="CDS homology"
##maf version=1
a score=150
s A4FUW6       94  44 +      221 SYMVSLEVGEEKHPVHLCKIMLFF-RSNPYFQNKVITKEYLVNIT
s chrY   51817253 131 - 59373566 SSTLS*QVEEVKHPVHLCKIMLFF/SDAPYFQNKVITEEYLVNVT

I tried uploading this as a custom track.  First, I have to replace
"chrY" with "hg19.chrY".  Then it uploads successfully, but the
display is messed up.  I guess that your software does not currently
allow for protein-level MAF alignments?

I appreciate you are all busy, and indeed you are doing a wonderful
job with the browser.  It would be even more wonderful if it could
handle protein-level MAF.  (This format includes the query sequences,
which solves one problem you mentioned.)  Just my hope...

Have a nice day,
Martin


On Wed, Oct 20, 2010 at 02:56:44PM -0700, Angie Hinrichs wrote:
> Hi Martin,
> 
> Regarding this part of your question:
> 
> > > By the way, can I / should I use any format other than PSL for a
> > > custom track of translated alignments?  I tried MAF, but it didn't
> > > work.  It would be nice if I could click on a track item and see the
> > > alignment.  It would be nice if stop codons and frameshifts were
> > > highlighted in red or something, is it possible to do that?
> 
> We don't have another format specifically for translated alignments.  Did MAF 
> not work for you because it is a nucleotide-level format, or some other 
> reason?  If you do have nucleotide-level alignments, and can output the BAM 
> format (http://genome.ucsc.edu/goldenPath/help/bam.html), nucleotide-level 
> differences are highlighted in the same way as hgBlat untranslated results.  
> 
> It would be a non-trivial enhancement to highlight codon differences in PSL 
> custom tracks -- we would need to add a way for you to upload query sequences 
> associated with your alignments (and for nucleotide-level PSL, CDS start and 
> stop for each query), and we don't yet display translated differences even in 
> in hgBlat results.  That would be very cool, but we all have pretty full 
> plates here already.  
> 
> Angie
> 
> ----- "Galt Barber" <[email protected]> wrote:
> 
> > From: "Galt Barber" <[email protected]>
> > To: "Martin Frith" <[email protected]>
> > Cc: [email protected]
> > Sent: Tuesday, October 19, 2010 4:43:36 PM GMT -08:00 US/Canada Pacific
> > Subject: Re: [Genome] custom track: translated psl strand bug
> >
> > Hi, Martin!
> > 
> > This does seem to be a bug in the PSL customTrack loader.
> > It should mark the strand as "-" instead of "+".
> > We will look into it.
> > 
> > Currently we convert PSL custom tracks to bed12.
> > So it really can't show un-aligned parts.
> > 
> > The BLAT track (hgBlat) does a much better job
> > of showing more details about the alignment.
> > 
> > Thank you for reporting the problem.
> > 
> > -Galt
> > 
> > 10/18/2010 7:05 PM, Martin Frith:
> > > Dear genome folks,
> > >
> > > I would like to display a custom track of protein-versus-genome
> > > alignments.  I tried using PSL format, but there seems to be a bug
> > > with "-" strands.
> > >
> > > For example, I blatted this sequence against hg19 with "output
> > type"
> > > set to hyperlink:
> > > LSVADHAPQFAVPSDTATAPQAESVLRPLYMDVQATTPL
> > >
> > > The output looks like this:
> > > SCORE START  END QSIZE IDENTITY CHRO STRAND  START    END      SPAN
> > >    63     1    39    39  77.0%    20  +-   34286403  34286519   
> > 117
> > > When I view it in the browser, the arrows go right-to-left, which
> > is
> > > correct.
> > >
> > > I repeated this blat with "output type" set to psl:
> > > match mis-  rep.        N's     Q gap   Q gap   T gap   T gap  
> > strand  ...
> > >        match match               count   bases   count   bases      
> >     ...
> > > 30    9     0           0       0       0       0       0       +-  
> >    ...
> > > I then pasted this PSL line into "add custom tracks".
> > > When I view it in the browser, the arrows go left-to-right, which
> > > seems wrong.
> > >
> > >
> > > By the way, can I / should I use any format other than PSL for a
> > > custom track of translated alignments?  I tried MAF, but it didn't
> > > work.  It would be nice if I could click on a track item and see
> > the
> > > alignment.  It would be nice if stop codons and frameshifts were
> > > highlighted in red or something, is it possible to do that?
> > >
> > > Have a nice day,
> > > Martin Frith
> > > http://www.cbrc.jp/~martin/
> > > _______________________________________________
> > > Genome maillist  -  [email protected]
> > > https://lists.soe.ucsc.edu/mailman/listinfo/genome
> > 
> > _______________________________________________
> > Genome maillist  -  [email protected]
> > https://lists.soe.ucsc.edu/mailman/listinfo/genome
_______________________________________________
Genome maillist  -  [email protected]
https://lists.soe.ucsc.edu/mailman/listinfo/genome

Reply via email to