Hi, Martin!

This has been fixed in customFactory.c
and you should see it in the next release
which will be v244.

Thanks again for reporting this.

-Galt

10/19/2010 4:43 PM, Galt Barber:
>
> Hi, Martin!
>
> This does seem to be a bug in the PSL customTrack loader.
> It should mark the strand as "-" instead of "+".
> We will look into it.
>
> Currently we convert PSL custom tracks to bed12.
> So it really can't show un-aligned parts.
>
> The BLAT track (hgBlat) does a much better job
> of showing more details about the alignment.
>
> Thank you for reporting the problem.
>
> -Galt
>
> 10/18/2010 7:05 PM, Martin Frith:
>> Dear genome folks,
>>
>> I would like to display a custom track of protein-versus-genome
>> alignments.  I tried using PSL format, but there seems to be a bug
>> with "-" strands.
>>
>> For example, I blatted this sequence against hg19 with "output type"
>> set to hyperlink:
>> LSVADHAPQFAVPSDTATAPQAESVLRPLYMDVQATTPL
>>
>> The output looks like this:
>> SCORE START  END QSIZE IDENTITY CHRO STRAND  START    END      SPAN
>>     63     1    39    39  77.0%    20  +-   34286403  34286519    117
>> When I view it in the browser, the arrows go right-to-left, which is
>> correct.
>>
>> I repeated this blat with "output type" set to psl:
>> match mis-  rep.        N's     Q gap   Q gap   T gap   T gap   strand  ...
>>         match match               count   bases   count   bases           ...
>> 30    9     0           0       0       0       0       0       +-      ...
>> I then pasted this PSL line into "add custom tracks".
>> When I view it in the browser, the arrows go left-to-right, which
>> seems wrong.
>>
>>
>> By the way, can I / should I use any format other than PSL for a
>> custom track of translated alignments?  I tried MAF, but it didn't
>> work.  It would be nice if I could click on a track item and see the
>> alignment.  It would be nice if stop codons and frameshifts were
>> highlighted in red or something, is it possible to do that?
>>
>> Have a nice day,
>> Martin Frith
>> http://www.cbrc.jp/~martin/
>> _______________________________________________
>> Genome maillist  -  [email protected]
>> https://lists.soe.ucsc.edu/mailman/listinfo/genome
>
> _______________________________________________
> Genome maillist  -  [email protected]
> https://lists.soe.ucsc.edu/mailman/listinfo/genome

_______________________________________________
Genome maillist  -  [email protected]
https://lists.soe.ucsc.edu/mailman/listinfo/genome

Reply via email to