Re: [ccp4bb] Unidentified density
+++1 Glycerol -- Kelvin Lau Protein production and structure core facility - PTPSP EPFL SV PTECH PTPSP AI 2146 (Bâtiment AI) Station 19 CH-1015 Lausanne Switzerland Email: kelvin@epfl.ch<mailto:kelvin@epfl.ch> Phone: +41 21 69 34494 On 21 Feb 2023, at 14:34, David Lawson (JIC) mailto:david.law...@jic.ac.uk>> wrote: Hi Zeya, Did you cryoprotect with glycerol perhaps? Dave --- Prof. David M. Lawson Department of Biochemistry and Metabolism, John Innes Centre, Norwich, NR4 7UH, UK. Tel: +44-(0)1603-450725 Web: https://www.jic.ac.uk/people/david-lawson Email: david.law...@jic.ac.uk<mailto:david.law...@jic.ac.uk> From: CCP4 bulletin board mailto:CCP4BB@JISCMAIL.AC.UK>> On Behalf Of zeyaul islam Sent: 21 February 2023 11:13 To: CCP4BB@JISCMAIL.AC.UK<mailto:CCP4BB@JISCMAIL.AC.UK> Subject: [ccp4bb] Unidentified density You don't often get email from zeya1...@gmail.com<mailto:zeya1...@gmail.com>. Learn why this is important<https://aka.ms/LearnAboutSenderIdentification> Dear all We have solved the structure of nanobody at 1.25 angstrom. We observe some unidentified density near the serine. Please have a look at the figures. Protein was purified in PBS buffer (137 mM NaCl, 2.7 mM KCl, 8 mM Na2HPO4, and 2 mM KH2PO4) and the crystallisation condition has 0.1 M BIS-TRIS pH 5.5, 2.0 M ammonium sulfate. Any ideas what this could be? I tried SO4 and PO4 but didn’t satisfy the observed electron density. I appreciate any help you can provide. Thanks Zeya Zeyaul Islam, PhD QBRI - Qatar Biomedical Research Institute P.O. Box: 34110 Doha – Qatar Tel: +974 445 46690 To unsubscribe from the CCP4BB list, click the following link: https://www.jiscmail.ac.uk/cgi-bin/WA-JISC.exe?SUBED1=CCP4BB=1 To unsubscribe from the CCP4BB list, click the following link: https://www.jiscmail.ac.uk/cgi-bin/WA-JISC.exe?SUBED1=CCP4BB=1 To unsubscribe from the CCP4BB list, click the following link: https://www.jiscmail.ac.uk/cgi-bin/WA-JISC.exe?SUBED1=CCP4BB=1 This message was issued to members of www.jiscmail.ac.uk/CCP4BB, a mailing list hosted by www.jiscmail.ac.uk, terms & conditions are available at https://www.jiscmail.ac.uk/policyandsecurity/
Re: [ccp4bb] Unidentified density
Hi Zeya, Did you cryoprotect with glycerol perhaps? Dave --- Prof. David M. Lawson Department of Biochemistry and Metabolism, John Innes Centre, Norwich, NR4 7UH, UK. Tel: +44-(0)1603-450725 Web: https://www.jic.ac.uk/people/david-lawson Email: david.law...@jic.ac.uk<mailto:david.law...@jic.ac.uk> From: CCP4 bulletin board On Behalf Of zeyaul islam Sent: 21 February 2023 11:13 To: CCP4BB@JISCMAIL.AC.UK Subject: [ccp4bb] Unidentified density You don't often get email from zeya1...@gmail.com<mailto:zeya1...@gmail.com>. Learn why this is important<https://aka.ms/LearnAboutSenderIdentification> Dear all We have solved the structure of nanobody at 1.25 angstrom. We observe some unidentified density near the serine. Please have a look at the figures. Protein was purified in PBS buffer (137 mM NaCl, 2.7 mM KCl, 8 mM Na2HPO4, and 2 mM KH2PO4) and the crystallisation condition has 0.1 M BIS-TRIS pH 5.5, 2.0 M ammonium sulfate. Any ideas what this could be? I tried SO4 and PO4 but didn’t satisfy the observed electron density. I appreciate any help you can provide. Thanks Zeya Zeyaul Islam, PhD QBRI - Qatar Biomedical Research Institute P.O. Box: 34110 Doha – Qatar Tel: +974 445 46690 To unsubscribe from the CCP4BB list, click the following link: https://www.jiscmail.ac.uk/cgi-bin/WA-JISC.exe?SUBED1=CCP4BB=1 To unsubscribe from the CCP4BB list, click the following link: https://www.jiscmail.ac.uk/cgi-bin/WA-JISC.exe?SUBED1=CCP4BB=1 This message was issued to members of www.jiscmail.ac.uk/CCP4BB, a mailing list hosted by www.jiscmail.ac.uk, terms & conditions are available at https://www.jiscmail.ac.uk/policyandsecurity/
Re: [ccp4bb] Unidentified density
This is always hard to see this way, but it looks like glycerol at first glance. Try to fit that. Cheers, Robbie > -Original Message- > From: CCP4 bulletin board On Behalf Of zeyaul > islam > Sent: Tuesday, February 21, 2023 12:13 > To: CCP4BB@JISCMAIL.AC.UK > Subject: [ccp4bb] Unidentified density > > Dear all > > We have solved the structure of nanobody at 1.25 angstrom. We observe some > unidentified density near the serine. Please have a look at the figures. > Protein > was purified in PBS buffer (137 mM NaCl, 2.7 mM KCl, 8 mM Na2HPO4, and 2 > mM KH2PO4) and the crystallisation condition has 0.1 M BIS-TRIS pH 5.5, 2.0 M > ammonium sulfate. Any ideas what this could be? I tried SO4 and PO4 but > didn’t satisfy the observed electron density. > > I appreciate any help you can provide. > > Thanks > > Zeya > > Zeyaul Islam, PhD > > QBRI - Qatar Biomedical Research Institute > > P.O. Box: 34110 > Doha – Qatar > > Tel: +974 445 46690 > > > > > > To unsubscribe from the CCP4BB list, click the following link: > https://www.jiscmail.ac.uk/cgi-bin/WA-JISC.exe?SUBED1=CCP4BB=1 To unsubscribe from the CCP4BB list, click the following link: https://www.jiscmail.ac.uk/cgi-bin/WA-JISC.exe?SUBED1=CCP4BB=1 This message was issued to members of www.jiscmail.ac.uk/CCP4BB, a mailing list hosted by www.jiscmail.ac.uk, terms & conditions are available at https://www.jiscmail.ac.uk/policyandsecurity/
Re: [ccp4bb] Unidentified density in coot
Looks like you're on the twofold axis, which will make interpretation challenging. Anything you put in may end up being too close to itself in the neighboring AU. What happens if you put in a water and display the symmetry? On Mon, Jun 23, 2014 at 8:17 AM, Shanti Pal Gangwar gangwar...@gmail.com wrote: Dear All I have solved a structure of my protein at 3.0 A. The crystallization condition is consisting of PEG400, NaCl, MgCl2 and Sodium citrate. The protein was purified in HEPES buffer. I can see an unidentified electron density blob in coot and I am not able to figure out what it could be? I have attached the snapshot of that blob with this mail. I request everyone to please help me in identification of this blob. Thanking you in advance. Shanti Pal Best regards Shanti Pal Gangwar, Ph.D School of Life Sciences Jawaharlal Nehru University New Delhi-110067 India Email:gangwar...@gmail.com -- [This e-mail message may contain privileged, confidential and/or proprietary information of H3 Biomedicine. If you believe that it has been sent to you in error, please contact the sender immediately and delete the message including any attachments, without copying, using, or distributing any of the information contained therein. This e-mail message should not be interpreted to include a digital or electronic signature that can be used to authenticate an agreement, contract or other legal document, nor to reflect an intention to be bound to any legally-binding agreement or contract.]
Re: [ccp4bb] Unidentified density in coot
Dear Shanti Looks like you’re looking down the symmetry axis - so this could simply be ‘noise’, or a superposition of two bound ligands on top of each other… what’s your cryo-protectant? With regards, Tony. - - - - - - - - - - - - - - - - - - Dr Antony W Oliver Senior Research Fellow CR-UK DNA Repair Enzymes Group Genome Damage and Stability Centre Science Park Road University of Sussex Falmer, Brighton, BN1 9RQ - - - - - - - - - - - - - - - - - - email: antony.oli...@sussex.ac.ukmailto:antony.oli...@sussex.ac.uk tel (office): +44 (0)1273 678349 tel (lab): +44 (0)1273 677512 http://www.sussex.ac.uk/lifesci/oliverlab http://tinyurl.com/aw-oliver - - - - - - - - - - - - - - - - - - On 23 Jun 2014, at 13:17, Shanti Pal Gangwar gangwar...@gmail.commailto:gangwar...@gmail.com wrote: Dear All I have solved a structure of my protein at 3.0 A. The crystallization condition is consisting of PEG400, NaCl, MgCl2 and Sodium citrate. The protein was purified in HEPES buffer. I can see an unidentified electron density blob in coot and I am not able to figure out what it could be? I have attached the snapshot of that blob with this mail. I request everyone to please help me in identification of this blob. Thanking you in advance. Shanti Pal Best regards Shanti Pal Gangwar, Ph.D School of Life Sciences Jawaharlal Nehru University New Delhi-110067 India Email:gangwar...@gmail.commailto:email%3agangwar...@gmail.com 2.png1.png
Re: [ccp4bb] Unidentified density in coot
Dear Shanti Pal, did you use ethylene glycol as cryoprotectant? It may even be there in small amounts in your PEG400 solution. As Nicholas and Tony have said, this could be noise (or could be distorted due to noise) as it's on a 2-fold axis. From those pictures, it looks to me like one molecule of ethylene glycol (Coot - Get Monomer - EDO). Don't forget to drop the occupancy to 0.5, though! Best Isaac On 23 June 2014 13:17, Shanti Pal Gangwar gangwar...@gmail.com wrote: Dear All I have solved a structure of my protein at 3.0 A. The crystallization condition is consisting of PEG400, NaCl, MgCl2 and Sodium citrate. The protein was purified in HEPES buffer. I can see an unidentified electron density blob in coot and I am not able to figure out what it could be? I have attached the snapshot of that blob with this mail. I request everyone to please help me in identification of this blob. Thanking you in advance. Shanti Pal Best regards Shanti Pal Gangwar, Ph.D School of Life Sciences Jawaharlal Nehru University New Delhi-110067 India Email:gangwar...@gmail.com
Re: [ccp4bb] unidentified density
Is this density on an 2 fold axis? From: CCP4 bulletin board [CCP4BB@JISCMAIL.AC.UK] On Behalf Of Sudhir Kumar [sudhir.1...@gmail.com] Sent: 17 October 2012 12:07 To: CCP4BB@JISCMAIL.AC.UK Subject: [ccp4bb] unidentified density Dear all, I have been working on the crystal structure of an enzyme in which I found the unidentified density (see images in attachments). Crystallization condition has Peg 1000, Peg 1500, Ethylene glycol, Tris and MPD. Does any one has any idea what it could be? Thanks -- best regards Sudhir Kumar Research Scholar C/O Dr. S. Gourinath Structural Biology Laboratory SLS, JNU, New Delhi-110067
Re: [ccp4bb] unidentified density
I think it might be PEG. u should try to fit that. On Wed, Oct 17, 2012 at 7:13 AM, RHYS GRINTER r.grinte...@research.gla.ac.uk wrote: Is this density on an 2 fold axis? From: CCP4 bulletin board [CCP4BB@JISCMAIL.AC.UK] On Behalf Of Sudhir Kumar [sudhir.1...@gmail.com] Sent: 17 October 2012 12:07 To: CCP4BB@JISCMAIL.AC.UK Subject: [ccp4bb] unidentified density Dear all, I have been working on the crystal structure of an enzyme in which I found the unidentified density (see images in attachments). Crystallization condition has Peg 1000, Peg 1500, Ethylene glycol, Tris and MPD. Does any one has any idea what it could be? Thanks -- best regards Sudhir Kumar Research Scholar C/O Dr. S. Gourinath Structural Biology Laboratory SLS, JNU, New Delhi-110067 -- Vandana kukshal
Re: [ccp4bb] unidentified density
I think it's MPD. I have also observed in my crystals. Amit Luthra, Ph.D. Post-Doctoral Fellow The Radolf Laboratory Department of Medicine University of Connecticut Health Center [e] alut...@uchc.edumailto:alut...@uchc.edu [p] 860/ 679 - 8390 From: CCP4 bulletin board [CCP4BB@JISCMAIL.AC.UK] On Behalf Of Vandna Kukshal [vanx...@gmail.com] Sent: Wednesday, October 17, 2012 12:38 PM To: CCP4BB@JISCMAIL.AC.UK Subject: Re: [ccp4bb] unidentified density I think it might be PEG. u should try to fit that. On Wed, Oct 17, 2012 at 7:13 AM, RHYS GRINTER r.grinte...@research.gla.ac.ukmailto:r.grinte...@research.gla.ac.uk wrote: Is this density on an 2 fold axis? From: CCP4 bulletin board [CCP4BB@JISCMAIL.AC.UKmailto:CCP4BB@JISCMAIL.AC.UK] On Behalf Of Sudhir Kumar [sudhir.1...@gmail.commailto:sudhir.1...@gmail.com] Sent: 17 October 2012 12:07 To: CCP4BB@JISCMAIL.AC.UKmailto:CCP4BB@JISCMAIL.AC.UK Subject: [ccp4bb] unidentified density Dear all, I have been working on the crystal structure of an enzyme in which I found the unidentified density (see images in attachments). Crystallization condition has Peg 1000, Peg 1500, Ethylene glycol, Tris and MPD. Does any one has any idea what it could be? Thanks -- best regards Sudhir Kumar Research Scholar C/O Dr. S. Gourinath Structural Biology Laboratory SLS, JNU, New Delhi-110067 -- Vandana kukshal
Re: [ccp4bb] unidentified density
Do you have matching 2Fo-Fc density? It is not obvious from the pictures. From: CCP4 bulletin board [mailto:CCP4BB@JISCMAIL.AC.UK] On Behalf Of Sudhir Kumar Sent: Thursday, 18 October 2012 12:07 a.m. To: CCP4BB@JISCMAIL.AC.UK Subject: [ccp4bb] unidentified density Dear all, I have been working on the crystal structure of an enzyme in which I found the unidentified density (see images in attachments). Crystallization condition has Peg 1000, Peg 1500, Ethylene glycol, Tris and MPD. Does any one has any idea what it could be? Thanks -- best regards Sudhir Kumar Research Scholar C/O Dr. S. Gourinath Structural Biology Laboratory SLS, JNU, New Delhi-110067
Re: [ccp4bb] unidentified density
Seems that this density is in a symmetry axis, if look is like that a mirror is crossing just in the middle of the density. If you really want to cover this density, I will try to fit with a small PEG molecule and some waters focusing yourself just on half of the density. R From: CCP4 bulletin board [mailto:CCP4BB@JISCMAIL.AC.UK] On Behalf Of Sudhir Kumar Sent: Wednesday, October 17, 2012 7:07 AM To: CCP4BB@JISCMAIL.AC.UK Subject: [ccp4bb] unidentified density Dear all, I have been working on the crystal structure of an enzyme in which I found the unidentified density (see images in attachments). Crystallization condition has Peg 1000, Peg 1500, Ethylene glycol, Tris and MPD. Does any one has any idea what it could be? Thanks -- best regards Sudhir Kumar Research Scholar C/O Dr. S. Gourinath Structural Biology Laboratory SLS, JNU, New Delhi-110067 This e-mail message (including any attachments) is for the sole use of the intended recipient(s) and may contain confidential and privileged information. If the reader of this message is not the intended recipient, you are hereby notified that any dissemination, distribution or copying of this message (including any attachments) is strictly prohibited. If you have received this message in error, please contact the sender by reply e-mail message and destroy all copies of the original message (including attachments).
Re: [ccp4bb] unidentified density
Thanks to the members for responding to my queries. I would like to summarize the post as: 1.Improve the crystals to have a better dataset. 2. Poly A/G modelling to improve the density and then model the sequence. 3. use of secondary structure prediction tools and docking the sequence accordingly. 4. use of buccaneer. i will post again once i get a reasonable model. regards intekhab alam On Fri, Feb 10, 2012 at 8:58 PM, Eleanor Dodson c...@ysbl.york.ac.ukwrote: On 02/10/2012 07:35 AM, intekhab alam wrote: Hi all I have a 3A dataset for a protein-protein complex. I have successfully build the first protein and refined it to R/Rfree 24/28. I can see some density for my second protein but the density is a bit noisy. I have attached the coot image of the density. I want to model the aminoacid having sequence as given peptide: MGKKGKNKKGRGRPGVFRTRGLTDEEYDEF**KKRRESRGGKYSIDDYLADREREEELLERD** EEEAIFGDGFGLE 1.Based on map features which segemnt should i start with. 2. Is there anyway that i can build the best fit segment of my second protein. I tried autobuild but it failed to build any peptide for my second protein. Your help is highly appreciated. regards Try buccaneer - it should work very easily with that density.. Eleanor -- INTEKHAB ALAM LABORATORY OF STRUCTURAL BIOINFORMATICS KOREA UNIVERSITY, SEOUL
Re: [ccp4bb] Unidentified density
Dear Sudhir, A blob surrounded by three Asp residues looks like a positively charged ion. What else (buffer, additives) is in your crystallization drop? I would also try to fit cysteine/serine. At 2 Å you will quickly see whether or not this is correct. Good luck! Herman From: CCP4 bulletin board [mailto:CCP4BB@JISCMAIL.AC.UK] On Behalf Of Sudhir Kumar Sent: Friday, February 10, 2012 7:06 AM To: CCP4BB@JISCMAIL.AC.UK Subject: [ccp4bb] Unidentified density Dear all, I have a 2 A structure of an enzyme which show 12 molecules per asymmetric unit. While placing waters i found out some blobs where i could not model any ligand. It is surrounded by 3 Asp molecules. I have attached screenshot of the blob at 1.5 sigma cutoff 2fo-fc density. Crystallization condition had following precipitants: PEG 1000, Peg 3350, MPD, Ethylene glycol,and protein contained Glycerol. My protein is known to bind Cysteine/Serine, though i haven't added any in crystallization buffer. any suggestion what it might be are welcome. thanks in advance -- best regards Sudhir Kumar Research Scholar C/O Dr. S. Gourinath Structural Biology Laboratory SLS, JNU, New Delhi-110067
Re: [ccp4bb] unidentified density
-BEGIN PGP SIGNED MESSAGE- Hash: SHA1 Hallo , first build a poly-ALA stretch. In coot or O this is conveniently achieved using baton-build mode. This should improve the phases. Then look at the side chains.Turbo-frodo has got somehting like a slider that shows the sequence on screen and which helps you identify bulky side chains. The pattern of a few bulky and non-bulkyside chains might already be sufficient to dock the sequence into the density. Also take the environment into account and think about what interactions between side chains of peptide and protein are plausible. You can also take the results from secondary structure prediction into account (e.g. http://toolkit.tuebingen.mpg.de/hhpred) - the density you show looks like an alpha-helix, and according to hhpred the stretch of sequence below contains two helices. Cheers, Tim On 02/10/2012 08:35 AM, intekhab alam wrote: Hi all I have a 3A dataset for a protein-protein complex. I have successfully build the first protein and refined it to R/Rfree 24/28. I can see some density for my second protein but the density is a bit noisy. I have attached the coot image of the density. I want to model the aminoacid having sequence as given peptide: MGKKGKNKKGRGRPGVFRTRGLTDEEYDEFKKRRESRGGKYSIDDYLADREREEELLERDEEEAIFGDGFGLE 1.Based on map features which segemnt should i start with. 2. Is there anyway that i can build the best fit segment of my second protein. I tried autobuild but it failed to build any peptide for my second protein. Your help is highly appreciated. regards - -- - -- Dr Tim Gruene Institut fuer anorganische Chemie Tammannstr. 4 D-37077 Goettingen GPG Key ID = A46BEE1A -BEGIN PGP SIGNATURE- Version: GnuPG v1.4.10 (GNU/Linux) Comment: Using GnuPG with Mozilla - http://enigmail.mozdev.org/ iD8DBQFPNOmBUxlJ7aRr7hoRArQMAJkBfnu04rQX2nBwgGN13qiwg68JzgCg0aL9 6C2LEaLZA37XVmQ+siX8yrg= =+AF/ -END PGP SIGNATURE-
Re: [ccp4bb] unidentified density
On 02/10/2012 07:35 AM, intekhab alam wrote: Hi all I have a 3A dataset for a protein-protein complex. I have successfully build the first protein and refined it to R/Rfree 24/28. I can see some density for my second protein but the density is a bit noisy. I have attached the coot image of the density. I want to model the aminoacid having sequence as given peptide: MGKKGKNKKGRGRPGVFRTRGLTDEEYDEFKKRRESRGGKYSIDDYLADREREEELLERDEEEAIFGDGFGLE 1.Based on map features which segemnt should i start with. 2. Is there anyway that i can build the best fit segment of my second protein. I tried autobuild but it failed to build any peptide for my second protein. Your help is highly appreciated. regards Try buccaneer - it should work very easily with that density.. Eleanor
Re: [ccp4bb] Unidentified density
hi sudhir, i think in second snapshot you can fit MPD as its structure is seems similar. . On Fri, Feb 10, 2012 at 11:36 AM, Sudhir Kumar sudhir.1...@gmail.comwrote: Dear all, I have a 2 A structure of an enzyme which show 12 molecules per asymmetric unit. While placing waters i found out some blobs where i could not model any ligand. It is surrounded by 3 Asp molecules. I have attached screenshot of the blob at 1.5 sigma cutoff 2fo-fc density. Crystallization condition had following precipitants: PEG 1000, Peg 3350, MPD, Ethylene glycol,and protein contained Glycerol. My protein is known to bind Cysteine/Serine, though i haven't added any in crystallization buffer. any suggestion what it might be are welcome. thanks in advance -- best regards Sudhir Kumar Research Scholar C/O Dr. S. Gourinath Structural Biology Laboratory SLS, JNU, New Delhi-110067 -- Vandana kukshal
[ccp4bb] Unidentified density.
I have MES, Tris, maleic acid and small PEG in my solution. No reducing agents and no cryo (and no salt or EDTA). Calcium seems to be the best fit (assuming 100 percent occupancy) and also literature suggests it. I tried Ni and Mn but they give negative density after refinement. Thank you all for your suggestions. Justyna
[ccp4bb] Unidentified density.
Dear All, I am refining structure of protein at 1.7A. It is enzyme with 3 histidine residues in the active site, which are chelating metal (at the moment I built in calcium but I do not know for sure, which metal is bound there). I can see additional density on top of metal, which I can not identify: http://picasaweb.google.com/j.a.wojdyla/Density# None of the crystallization or protein buffer's components could fit there and it seems to be something picked up during expression. I would be very grateful for any suggestions. Thank you in advance. Justyna
Re: [ccp4bb] Unidentified density.
Nevertheless, what do you have in mother liquor/protein buffer? On Thu, 2010-08-12 at 17:24 +0200, wrote: Dear All, I am refining structure of protein at 1.7A. It is enzyme with 3 histidine residues in the active site, which are chelating metal (at the moment I built in calcium but I do not know for sure, which metal is bound there). I can see additional density on top of metal, which I can not identify: http://picasaweb.google.com/j.a.wojdyla/Density# None of the crystallization or protein buffer's components could fit there and it seems to be something picked up during expression. I would be very grateful for any suggestions. Thank you in advance. Justyna -- Edwin Pozharski, PhD, Assistant Professor University of Maryland, Baltimore -- When the Way is forgotten duty and justice appear; Then knowledge and wisdom are born along with hypocrisy. When harmonious relationships dissolve then respect and devotion arise; When a nation falls to chaos then loyalty and patriotism are born. -- / Lao Tse /
Re: [ccp4bb] Unidentified density.
Could this be a metal cluster? Is your protein solution colored at all? Have you made an anomalous difference map? Is there reductant in the mix? What small molecules were in the mother liquor? JPK - Original Message - From: Justyna Wojdyla ty...@embl-hamburg.de To: CCP4BB@JISCMAIL.AC.UK Sent: Thursday, August 12, 2010 10:24 AM Subject: [ccp4bb] Unidentified density. Dear All, I am refining structure of protein at 1.7A. It is enzyme with 3 histidine residues in the active site, which are chelating metal (at the moment I built in calcium but I do not know for sure, which metal is bound there). I can see additional density on top of metal, which I can not identify: http://picasaweb.google.com/j.a.wojdyla/Density# None of the crystallization or protein buffer's components could fit there and it seems to be something picked up during expression. I would be very grateful for any suggestions. Thank you in advance. Justyna *** Jacob Pearson Keller Northwestern University Medical Scientist Training Program Dallos Laboratory F. Searle 1-240 2240 Campus Drive Evanston IL 60208 lab: 847.491.2438 cel: 773.608.9185 email: j-kell...@northwestern.edu ***
