Hi, I send you the mzxml file through wetransfer. I tried with this command * /opt/tpp/bin/PTMProphetParser STY,79.966,K,14.0156,M,15.995 MZTOL=0.2 /opt/tpp/data/327_05_01/327_05_01_020_150417_01_MTCS_0_D_interact.iproph.pep.xml interact.ptm.pep.xml *
I got these warnings: INFO: Writing file interact.ptm.pep.xml ... INFO: Reading file /opt/tpp/data/327_05_01/327_05_01_020_150417_01_MTCS_0_D_interact.iproph.pep.xml ...WARNING: Illegal peptide with unknown mod: GTAGK[142]VIK[142]WARNING: Illegal peptide with unknown mod: ILVAIM[147]K[142]WARNING: Illegal peptide with unknown mod: VTNLHVK[142]WARNING: Illegal peptide with unknown mod: ALK[142]EPPRWARNING: Illegal peptide with unknown mod: ALK[142]EPPRWARNING: Illegal peptide with unknown mod: ALK[142]EPPRWARNING: Illegal peptide with unknown mod: K[142]EGVK[142]PRWARNING: Illegal peptide with unknown mod: VLEPENK[142]WARNING: Illegal peptide with unknown mod: VLNILEK[142]WARNING: Illegal peptide with unknown mod: WLVVPDK[142]WARNING: Illegal peptide with unknown mod: LLLTTPAK[142]WARNING: Illegal peptide with unknown mod: K[142]PHPPKRWARNING: Illegal peptide with unknown mod: KPHPPK[142]RWARNING: Illegal peptide with unknown mod: DADFNGTK[142]WARNING: Illegal peptide with unknown mod: LYSC[160]TPRWARNING: Illegal peptide with unknown mod: KAVVVC[160]PKWARNING: Illegal peptide with unknown mod: KTPM[147]C[160]EKWARNING: Illegal peptide with unknown mod: LAALAEALK[142]WARNING: Illegal peptide with unknown mod: VK[142]THLFRWARNING: Illegal peptide with unknown mod: M[147]EFLKQKWARNING: Illegal peptide with unknown mod: M[147]DK[142]TFERWARNING: Illegal peptide with unknown mod: GAGM[147]SFSRKWARNING: Illegal peptide with unknown mod: ALLVYC[160]VKWARNING: Illegal peptide with unknown mod: ALLVYC[160]VKWARNING: Illegal peptide with unknown mod: VFISC[160]K[142]VQWARNING: Illegal peptide with unknown mod: VM[147]LYPSRIWARNING: Illegal peptide with unknown mod: M[147]C[160]GDC[160]VEKWARNING: Illegal peptide with unknown mod: LSLHLSPIK[142]WARNING: Illegal peptide with unknown mod: M[147]SVNISTAGKWARNING: Illegal peptide with unknown mod: NLMANRPAK[142]WARNING: Illegal peptide with unknown mod: TAM[147]LLALQRWARNING: Illegal peptide with unknown mod: LSSC[160]KPPKKWARNING: Illegal peptide with unknown mod: K[142]QLYPFFKWARNING: Illegal peptide with unknown mod: KQLYPFFK[142]WARNING: Illegal peptide with unknown mod: TK[142]LNYNPPKWARNING: Illegal peptide with unknown mod: TKLNYNPPK[142]WARNING: Illegal peptide with unknown mod: IIK[142]ALDLPAKWARNING: Illegal peptide with unknown mod: IIKALDLPAK[142]WARNING: Illegal peptide with unknown mod: VK[142]PNVAVLSRWARNING: Illegal peptide with unknown mod: ASSLPSSAPAVK[142]WARNING: Illegal peptide with unknown mod: SLASSAQPGLGK[142]WARNING: Illegal peptide with unknown mod: AEM[147]EELM[147]EKWARNING: Illegal peptide with unknown mod: NDC[160]TTQSNVKWARNING: Illegal peptide with unknown mod: LNK[142]TPIPQTK[142]WARNING: Illegal peptide with unknown mod: SSLLGTGITSPK[142]WARNING: Illegal peptide with unknown mod: LIDLC[160]QPTQK[142]WARNING: Illegal peptide with unknown mod: RNQDRPSLLK[142]WARNING: Illegal peptide with unknown mod: K[142]RPDEMLLPKWARNING: Illegal peptide with unknown mod: KRPDEMLLPK[142]WARNING: Illegal peptide with unknown mod: LAERPNIKM[147]RWARNING: Illegal peptide with unknown mod: K[142]ITGEIMHALKWARNING: Illegal peptide with unknown mod: KITGEIMHALK[142]WARNING: Illegal peptide with unknown mod: NVQTPQC[160]K[142]LRWARNING: Illegal peptide with unknown mod: VGAWGISGEPRK[142]WARNING: Illegal peptide with unknown mod: DLLHPSPEEEK[142]WARNING: Illegal peptide with unknown mod: GALGPGGPLGHPGEK[142]WARNING: Illegal peptide with unknown mod: KAGTVM[147]FEYGMRWARNING: Illegal peptide with unknown mod: KAGTVMFEYGM[147]RWARNING: Illegal peptide with unknown mod: REENQNEVNM[147]KWARNING: Illegal peptide with unknown mod: K[142]NSGC[160]TEVC[160]HTRWARNING: Illegal peptide with unknown mod: QILLLLPVM[147]INM[147]LK[142]WARNING: Illegal peptide with unknown mod: QILLLLPVM[147]INM[147]LK[142]WARNING: Illegal peptide with unknown mod: LQGEGLSVAGIVC[160]HVGKWARNING: Illegal peptide with unknown mod: SWAEAYK[142]DLENSDEFK[142]WARNING: Illegal peptide with unknown mod: DLVSGGSNEGNGK[142]EDWAMK[142]WARNING: Illegal peptide with unknown mod: AVATGKM[147]DENQFVAVTSTNAAKWARNING: Illegal peptide with unknown mod: LPMASSMEHGK[142]DLPSVQLLMK[142]WARNING: Illegal peptide with unknown mod: M[147]QILTPPLQSSVELVADPETRWARNING: Illegal peptide with unknown mod: LTPTEIVLILPM[147]PEQRNSLTAK[142]WARNING: Illegal peptide with unknown mod: QKLC[160]YVSQGNASFTYGYEYLGC[160]TSRWARNING: Illegal peptide with unknown mod: DNEIQMDMTLGPIEEAYAILNRFEVEVTK[142]WARNING: Illegal peptide with unknown mod: QM[147]GQEIGNELDEQNEIIDDLANLVENTDEK[142]WARNING: Illegal peptide with unknown mod: HLVC[160]SFRLYPFTVHTVSPGNSHLALYQVFK[142]WARNING: Illegal peptide with unknown mod: EVK[142]VYLLTTSSAPYC[160]NAFQLLTVAPNHGISLK[142]WARNING: Illegal peptide with unknown mod: K[142]GNFQLQGTM[147]LSDGQGFTQDDVQAAEVTYGAMARWARNING: Illegal peptide with unknown mod: K[142]GNFQLQGTMLSDGQGFTQDDVQAAEVTYGAM[147]ARWARNING: Illegal peptide with unknown mod: EESLHSILAGSDM[147]TVSQILLTQHGIPVM[147]NLSDGK[142]WARNING: Illegal peptide with unknown mod: DPPAQC[160]SAGPVGDDM[147]FHWQATIM[147]GPISNYMLDNWARNING: Illegal peptide with unknown mod: DPPAQC[160]SAGPVGDDM[147]FHWQATIMGPISNYM[147]LDNWARNING: Illegal peptide with unknown mod: DPPAQC[160]SAGPVGDDMFHWQATIM[147]GPISNYM[147]LDNWARNING: Illegal peptide with unknown mod: LYC[160]NGDGEWM[147]VPIGRC[160]TC[160]K[142]PGYEPENSVAC[160]KWARNING: Illegal peptide with unknown mod: LYC[160]NGDGEWM[147]VPIGRC[160]TC[160]KPGYEPENSVAC[160]K[142]WARNING: Illegal peptide with unknown mod: ASVDSGNEDIIEALISLFYGVM[147]TPMLNPLIYSLRWARNING: Illegal peptide with unknown mod: ASVDSGNEDIIEALISLFYGVMTPM[147]LNPLIYSLRWARNING: Illegal peptide with unknown mod: M[147]GFNRPSKIQENALPLMLAEPPQNLIAQSQSGTGKWARNING: Illegal peptide with unknown mod: MGFNRPSKIQENALPLM[147]LAEPPQNLIAQSQSGTGKWARNING: Illegal peptide with unknown mod: GFPSQC[160]YSAQTLPELC[160]SPQDELDFLM[147]EALIISKWARNING: Illegal peptide with unknown mod: LYTM[147]DGITVTVADLFFAGTETTSTTLRYGLLILMK[142]WARNING: Illegal peptide with unknown mod: LYTMDGITVTVADLFFAGTETTSTTLRYGLLILM[147]K[142]WARNING: Illegal peptide with unknown mod: FVHKSFVEVNEEGTEAAAASSC[160]FVVAEC[160]C[160]M[147]ESGPRWARNING: Illegal peptide with unknown mod: GPLLAQEM[147]PTVSVLEYALPQRPPQGPEDDRDLSER Failed to open input file '/opt/tpp/data/327_05_01/spectrast/327_05_01_020_150417_01.mzXML'.ERROR: cannot read scan in data file /opt/tpp/data/327_05_01/spectrast/327_05_01_020_150417_01.mzXML exiting ... There is an error at the end. I don't understand why it is looking for the mzxml file in the spectrast folder... Thus I copied the mzxml file to the spectrast folder and it seems to work. Could you please check if the latest PTMprophet version gives the same warnings? Thanks for your help :-) Delphine 2015-04-29 19:30 GMT+02:00 David Shteynberg < [email protected]>: > Hi, > > There may be several things going on here, which will require a new copy > of PTMProphet for you to process the results. I think that you are using > an older version of PTMProphet which has seen recent improvements to cover > more PTM user cases. PTMProphet compares the internally calculated mass to > the search engine reported mass, these may not agree and cause this problem > for the K[142] peptides. The other peptides are M containing with oxidized > Methionine so you PTMProphet settings should include M,15.9949 to make > those go away. If you also send the mzXML file, I can try the latest code > on you data. > > > Thanks, > -David > > On Wed, Apr 29, 2015 at 8:16 AM, Delphine <[email protected]> wrote: > >> Hello, >> >> I'm trying to use ptmprophet to identify methylation on lysines. First I >> identify the peptides with comet, xtandem, spectraST and mascot. Here are >> the lines where the modification is discribed in the xtandem and comet >> parameter files I used: >> comet: variable_mod02 = 14.015650 K 0 3 -1 0 >> xtandem: <note type="input" label="residue, potential modification >> mass">15.994915@M,14.015650@K</note> >> >> I combine the 4 results with iprophet (file joined) and tried to use >> PTMprophet on this file. >> >> Here is the command line: >> * cd /opt/tpp/data/327_05_01; /opt/tpp/bin/PTMProphetParser K,14.0156 >> MZTOL=0.2 >> /opt/tpp/data/327_05_01/327_05_01_020_150417_01_MTCS_0_D_interact.iproph.pep.xml >> interact.ptm.pep.xml * >> >> And here is the error message: >> >> INFO: Writing file interact.ptm.pep.xml ... >> INFO: Reading file >> /opt/tpp/data/327_05_01/327_05_01_020_150417_01_MTCS_0_D_interact.iproph.pep.xml >> ...WARNING: Illegal peptide with unknown mod: GTAGK[142]VIK[142]WARNING: >> Illegal peptide with unknown mod: ILVAIMK[142]WARNING: Illegal peptide with >> unknown mod: VTNLHVK[142]WARNING: Illegal peptide with unknown mod: >> ALK[142]EPPRWARNING: Illegal peptide with unknown mod: ALK[142]EPPRWARNING: >> Illegal peptide with unknown mod: ALK[142]EPPRWARNING: Illegal peptide with >> unknown mod: K[142]EGVK[142]PRWARNING: Illegal peptide with unknown mod: >> VLEPENK[142]WARNING: Illegal peptide with unknown mod: VLNILEK[142]WARNING: >> Illegal peptide with unknown mod: WLVVPDK[142]WARNING: Illegal peptide with >> unknown mod: LLLTTPAK[142]WARNING: Illegal peptide with unknown mod: >> K[142]PHPPKRWARNING: Illegal peptide with unknown mod: KPHPPK[142]RWARNING: >> Illegal peptide with unknown mod: DADFNGTK[142]WARNING: Illegal peptide with >> unknown mod: LYSC[160]TPRWARNING: Illegal peptide with unknown mod: >> KAVVVC[160]PKWARNING: Illegal peptide with unknown mod: KTPMC[160]EKWARNING: >> Illegal peptide with unknown mod: LAALAEALK[142]WARNING: Illegal peptide >> with unknown mod: VK[142]THLFRWARNING: Illegal peptide with unknown mod: >> MEFLKQKWARNING: Illegal peptide with unknown mod: MDK[142]TFERWARNING: >> Illegal peptide with unknown mod: GAGMSFSRKWARNING: Illegal peptide with >> unknown mod: ALLVYC[160]VKWARNING: Illegal peptide with unknown mod: >> ALLVYC[160]VKWARNING: Illegal peptide with unknown mod: >> VFISC[160]K[142]VQWARNING: Illegal peptide with unknown mod: >> VMLYPSRIWARNING: Illegal peptide with unknown mod: >> MC[160]GDC[160]VEKWARNING: Illegal peptide with unknown mod: >> LSLHLSPIK[142]WARNING: Illegal peptide with unknown mod: MSVNISTAGKWARNING: >> Illegal peptide with unknown mod: NLMANRPAK[142]WARNING: Illegal peptide >> with unknown mod: TAMLLALQRWARNING: Illegal peptide with unknown mod: >> LSSC[160]KPPKKWARNING: Illegal peptide with unknown mod: >> K[142]QLYPFFKWARNING: Illegal peptide with unknown mod: >> KQLYPFFK[142]WARNING: Illegal peptide with unknown mod: >> TK[142]LNYNPPKWARNING: Illegal peptide with unknown mod: >> TKLNYNPPK[142]WARNING: Illegal peptide with unknown mod: >> IIK[142]ALDLPAKWARNING: Illegal peptide with unknown mod: >> IIKALDLPAK[142]WARNING: Illegal peptide with unknown mod: >> VK[142]PNVAVLSRWARNING: Illegal peptide with unknown mod: >> ASSLPSSAPAVK[142]WARNING: Illegal peptide with unknown mod: >> SLASSAQPGLGK[142]WARNING: Illegal peptide with unknown mod: >> AEMEELMEKWARNING: Illegal peptide with unknown mod: NDC[160]TTQSNVKWARNING: >> Illegal peptide with unknown mod: LNK[142]TPIPQTK[142]WARNING: Illegal >> peptide with unknown mod: SSLLGTGITSPK[142]WARNING: Illegal peptide with >> unknown mod: LIDLC[160]QPTQK[142]WARNING: Illegal peptide with unknown mod: >> RNQDRPSLLK[142]WARNING: Illegal peptide with unknown mod: >> K[142]RPDEMLLPKWARNING: Illegal peptide with unknown mod: >> KRPDEMLLPK[142]WARNING: Illegal peptide with unknown mod: LAERPNIKMRWARNING: >> Illegal peptide with unknown mod: K[142]ITGEIMHALKWARNING: Illegal peptide >> with unknown mod: KITGEIMHALK[142]WARNING: Illegal peptide with unknown mod: >> NVQTPQC[160]K[142]LRWARNING: Illegal peptide with unknown mod: >> VGAWGISGEPRK[142]WARNING: Illegal peptide with unknown mod: >> DLLHPSPEEEK[142]WARNING: Illegal peptide with unknown mod: >> GALGPGGPLGHPGEK[142]WARNING: Illegal peptide with unknown mod: >> KAGTVMFEYGMRWARNING: Illegal peptide with unknown mod: REENQNEVNMKWARNING: >> Illegal peptide with unknown mod: K[142]NSGC[160]TEVC[160]HTRWARNING: >> Illegal peptide with unknown mod: QILLLLPVMINMLK[142]WARNING: Illegal >> peptide with unknown mod: QILLLLPVMINMLK[142]WARNING: Illegal peptide with >> unknown mod: LQGEGLSVAGIVC[160]HVGKWARNING: Illegal peptide with unknown >> mod: SWAEAYK[142]DLENSDEFK[142]WARNING: Illegal peptide with unknown mod: >> DLVSGGSNEGNGK[142]EDWAMK[142]WARNING: Illegal peptide with unknown mod: >> AVATGKMDENQFVAVTSTNAAKWARNING: Illegal peptide with unknown mod: >> LPMASSMEHGK[142]DLPSVQLLMK[142]WARNING: Illegal peptide with unknown mod: >> MQILTPPLQSSVELVADPETRWARNING: Illegal peptide with unknown mod: >> LTPTEIVLILPMPEQRNSLTAK[142]WARNING: Illegal peptide with unknown mod: >> QKLC[160]YVSQGNASFTYGYEYLGC[160]TSRWARNING: Illegal peptide with unknown >> mod: DNEIQMDMTLGPIEEAYAILNRFEVEVTK[142]WARNING: Illegal peptide with unknown >> mod: QMGQEIGNELDEQNEIIDDLANLVENTDEK[142]WARNING: Illegal peptide with >> unknown mod: HLVC[160]SFRLYPFTVHTVSPGNSHLALYQVFK[142]WARNING: Illegal >> peptide with unknown mod: >> EVK[142]VYLLTTSSAPYC[160]NAFQLLTVAPNHGISLK[142]WARNING: Illegal peptide with >> unknown mod: K[142]GNFQLQGTMLSDGQGFTQDDVQAAEVTYGAMARWARNING: Illegal peptide >> with unknown mod: EESLHSILAGSDMTVSQILLTQHGIPVMNLSDGK[142]WARNING: Illegal >> peptide with unknown mod: DPPAQC[160]SAGPVGDDMFHWQATIMGPISNYMLDNWARNING: >> Illegal peptide with unknown mod: >> LYC[160]NGDGEWMVPIGRC[160]TC[160]K[142]PGYEPENSVAC[160]KWARNING: Illegal >> peptide with unknown mod: >> LYC[160]NGDGEWMVPIGRC[160]TC[160]KPGYEPENSVAC[160]K[142]WARNING: Illegal >> peptide with unknown mod: ASVDSGNEDIIEALISLFYGVMTPMLNPLIYSLRWARNING: Illegal >> peptide with unknown mod: MGFNRPSKIQENALPLMLAEPPQNLIAQSQSGTGKWARNING: >> Illegal peptide with unknown mod: >> GFPSQC[160]YSAQTLPELC[160]SPQDELDFLMEALIISKWARNING: Illegal peptide with >> unknown mod: LYTMDGITVTVADLFFAGTETTSTTLRYGLLILMK[142]WARNING: Illegal >> peptide with unknown mod: >> FVHKSFVEVNEEGTEAAAASSC[160]FVVAEC[160]C[160]MESGPRWARNING: Illegal peptide >> with unknown mod: GPLLAQEMPTVSVLEYALPQRPPQGPEDDRDLSERWARNING: Illegal >> peptide with unknown mod: GGEC[160]HGMDAEQEMRWARNING: Illegal peptide with >> unknown mod: WAAVMVPSGEEQRWARNING: Illegal peptide with unknown mod: >> MTSMMC[160]TVMLK[142]TWARNING: Illegal peptide with unknown mod: >> MSFSEMNRWARNING: Illegal peptide with unknown mod: MSFAGTVAWMAPEVIRWARNING: >> Illegal peptide with unknown mod: GSQDFSFREIMGSRWARNING: Illegal peptide >> with unknown mod: RAVGIWHC[160]GSC[160]MKWARNING: Illegal peptide with >> unknown mod: RAVGIWHC[160]GSC[160]MKWARNING: Illegal peptide with unknown >> mod: EMSEEMDK[142]WARNING: Illegal peptide with unknown mod: >> RAVGIWHC[160]GSC[160]MKWARNING: Illegal peptide with unknown mod: >> MVLLAGTGPEGGGARWARNING: Illegal peptide with unknown mod: >> QDFNMMEQRK[142]WARNING: Illegal peptide with unknown mod: >> MEAMGEWNPNVKWARNING: Illegal peptide with unknown mod: >> AVGIWHC[160]GSC[160]MKWARNING: Illegal peptide with unknown mod: >> TK[142]EMDVYGITDKWARNING: Illegal peptide with unknown mod: >> TKEMDVYGITDK[142]WARNING: Illegal peptide with unknown mod: >> RAVGIWHC[160]GSC[160]MKWARNING: Illegal peptide with unknown mod: >> RAVGIWHC[160]GSC[160]MKWARNING: Illegal peptide with unknown mod: >> VMAMAIDYRWARNING: Illegal peptide with unknown mod: >> RAVGIWHC[160]GSC[160]MKWARNING: Illegal peptide with unknown mod: >> AVGIWHC[160]GSC[160]MKWARNING: Illegal peptide with unknown mod: >> AVGIWHC[160]GSC[160]MKWARNING: Illegal peptide with unknown mod: >> RAVGIWHC[160]GSC[160]MKWARNING: Illegal peptide with unknown mod: >> IKFEMEQNLRWARNING: Illegal peptide with unknown mod: MNGLRNKWARNING: Illegal >> peptide with unknown mod: RAVGIWHC[160]GSC[160]MKWARNING: Illegal peptide >> with unknown mod: AVGIWHC[160]GSC[160]MKWARNING: Illegal peptide with >> unknown mod: AVGIWHC[160]GSC[160]MKWARNING: Illegal peptide with unknown >> mod: AVGIWHC[160]GSC[160]MKWARNING: Illegal peptide with unknown mod: >> RAVGIWHC[160]GSC[160]MKWARNING: Illegal peptide with unknown mod: >> VMLYPSRWARNING: Illegal peptide with unknown mod: >> RAVGIWHC[160]GSC[160]MKWARNING: Illegal peptide with unknown mod: >> VMLYPSRWARNING: Illegal peptide with unknown mod: KLIMEAMKWARNING: Illegal >> peptide with unknown mod: MC[160]GDC[160]VEKWARNING: Illegal peptide with >> unknown mod: SESMDYSRWARNING: Illegal peptide with unknown mod: >> GMPGGRNLYKWARNING: Illegal peptide with unknown mod: >> AVGIWHC[160]GSC[160]MKWARNING: Illegal peptide with unknown mod: >> RAVGIWHC[160]GSC[160]MKWARNING: Illegal peptide with unknown mod: >> MNAFYDAQVEFVKWARNING: Illegal peptide with unknown mod: IITVMSMGMKWARNING: >> Illegal peptide with unknown mod: LNIFDMMAVTKWARNING: Illegal peptide with >> unknown mod: RAVGIWHC[160]GSC[160]MKWARNING: Illegal peptide with unknown >> mod: DVDNAYMIKWARNING: Illegal peptide with unknown mod: >> RAVGIWHC[160]GSC[160]MKWARNING: Illegal peptide with unknown mod: >> MNWENESSPKWARNING: Illegal peptide with unknown mod: LNIFDMMAVTKWARNING: >> Illegal peptide with unknown mod: YYADGEDAYAMKWARNING: Illegal peptide with >> unknown mod: APAMFNIRWARNING: Illegal peptide with unknown mod: >> RAVGIWHC[160]GSC[160]MKWARNING: Illegal peptide with unknown mod: >> APAMFNIRWARNING: Illegal peptide with unknown mod: GFMVQTGDPTGTGRWARNING: >> Illegal peptide with unknown mod: RAVGIWHC[160]GSC[160]MKWARNING: Illegal >> peptide with unknown mod: MTLDDFRWARNING: Illegal peptide with unknown mod: >> RAVGIWHC[160]GSC[160]MKWARNING: Illegal peptide with unknown mod: >> RAVGIWHC[160]GSC[160]MKWARNING: Illegal peptide with unknown mod: >> QVLDNLTMEKWARNING: Illegal peptide with unknown mod: QVLDNLTMEKWARNING: >> Illegal peptide with unknown mod: RAVGIWHC[160]GSC[160]MKWARNING: Illegal >> peptide with unknown mod: RAVGIWHC[160]GSC[160]MKWARNING: Illegal peptide >> with unknown mod: QVLDNLTMEKWARNING: Illegal peptide with unknown mod: >> NTPGFMYK[142]WARNING: Illegal peptide with unknown mod: >> RAVGIWHC[160]GSC[160]MKWARNING: Illegal peptide with unknown mod: >> RAVGIWHC[160]GSC[160]MKWARNING: Illegal peptide with unknown mod: >> RAVGIWHC[160]GSC[160]MKWARNING: Illegal peptide with unknown mod: >> EGMLMMMSPSPRWARNING: Illegal peptide with unknown mod: >> RAVGIWHC[160]GSC[160]MKWARNING: Illegal peptide with unknown mod: >> RAVGIWHC[160]GSC[160]MKWARNING: Illegal peptide with unknown mod: >> RAVGIWHC[160]GSC[160]MKWARNING: Illegal peptide with unknown mod: >> K[142]ALMPPVKWARNING: Illegal peptide with unknown mod: >> KALMPPVK[142]WARNING: Illegal peptide with unknown mod: >> K[142]PVMPK[142]KWARNING: Illegal peptide with unknown mod: >> K[142]PVMPKK[142]WARNING: Illegal peptide with unknown mod: >> KPVMPK[142]K[142]WARNING: Illegal peptide with unknown mod: >> K[142]PVMPK[142]KWARNING: Illegal peptide with unknown mod: >> K[142]PVMPKK[142]WARNING: Illegal peptide with unknown mod: >> KPVMPK[142]K[142]WARNING: Illegal peptide with unknown mod: >> VTMQK[142]SDDVLHDLGQKWARNING: Illegal peptide with unknown mod: >> VTMQKSDDVLHDLGQK[142]WARNING: Illegal peptide with unknown mod: >> VMLYPSRIWARNING: Illegal peptide with unknown mod: VMLYPSRIWARNING: Illegal >> peptide with unknown mod: VMLYPSRIWARNING: Illegal peptide with unknown mod: >> VMLYPSRIWARNING: Illegal peptide with unknown mod: MAGGLFAVSKKWARNING: >> Illegal peptide with unknown mod: IGQQLGMTFISVGHRWARNING: Illegal peptide >> with unknown mod: VMLYPSRIWARNING: Illegal peptide with unknown mod: >> VMLYPSRIWARNING: Illegal peptide with unknown mod: K[142]PVMPK[142]KWARNING: >> Illegal peptide with unknown mod: K[142]PVMPKK[142]WARNING: Illegal peptide >> with unknown mod: KPVMPK[142]K[142]WARNING: Illegal peptide with unknown >> mod: VMLYPSRIWARNING: Illegal peptide with unknown mod: >> LEVVAIFGSVQMAMSRIINLHHHRWARNING: Illegal peptide with unknown mod: >> GLIFYDTKVTVMNRWARNING: Illegal peptide with unknown mod: >> LK[142]LSHLVQYEELPDYIMVMVANK[142]WARNING: Illegal peptide with unknown mod: >> AVLVDLEPGTMDSVRWARNING: Illegal peptide with unknown mod: >> AVLVDLEPGTMDSVRWARNING: Illegal peptide with unknown mod: TMADQQARR >> WARNING: Unrecognized mod on peptide: TVVGQITVDM[147]WARNING: Cannot >> initialize for sequence: TVVGQITVDM[147], unknown mods may exist in spectrum >> 327_05_01_020_150417_01.05584.05584.2 >> Segmentation fault >> >> >> I am not very familliar with the search of PTM.... >> Thanks in advance for your help! >> >> Delphine >> >> -- >> You received this message because you are subscribed to the Google Groups >> "spctools-discuss" group. >> To unsubscribe from this group and stop receiving emails from it, send an >> email to [email protected]. >> To post to this group, send email to [email protected]. >> Visit this group at http://groups.google.com/group/spctools-discuss. >> For more options, visit https://groups.google.com/d/optout. >> > > -- > You received this message because you are subscribed to a topic in the > Google Groups "spctools-discuss" group. > To unsubscribe from this topic, visit > https://groups.google.com/d/topic/spctools-discuss/Af65TfANAl0/unsubscribe > . > To unsubscribe from this group and all its topics, send an email to > [email protected]. > To post to this group, send email to [email protected]. > Visit this group at http://groups.google.com/group/spctools-discuss. > For more options, visit https://groups.google.com/d/optout. > -- You received this message because you are subscribed to the Google Groups "spctools-discuss" group. To unsubscribe from this group and stop receiving emails from it, send an email to [email protected]. To post to this group, send email to [email protected]. Visit this group at http://groups.google.com/group/spctools-discuss. For more options, visit https://groups.google.com/d/optout.
