Hello Jesse,

There have been many bug fixes and improvements made to PTMProphet since
the last release.  You can test out the new binary by replacing your
PTMProphetParser.exe file in C:\Inetpu\tpp-bin with this pre-release
version made for TPP 5:
https://dl.dropboxusercontent.com/u/21286225/PTMProphetParser.exe


I ran it on your file without the WARNING messages as follows:

PTMProphetParser.exe K:42.010565,M:15.994915,NQ:0.984016 MZTOL=0.055
interact-160611_0001_fulldia_1_q1_msgf.pep.xml msgf.test1.interact.ptm.pep.xml


Let us know should other issues arise.

Thank you,
-David





On Wed, Jul 20, 2016 at 12:22 PM, Jesse <[email protected]> wrote:

> Hello David,
>
> I'm having a related issue.  I'm searching with Comet, X!tandem, and
> MSGF+, and results from MSGF+ or tandem that have been filtered with
> peptide prophet using xinteract.  When I run the following on files from
> MSGF+ searches or X!tandem searches:
>
> *EXECUTING: cd c:/Inetpub/wwwroot/ISB/data/allDIAv3&
> c:\Inetpub\tpp-bin\PTMProphetParser K,42.010565,M,15.994915,NQ,0.984016
> MZTOL=0.055
> c:/Inetpub/wwwroot/ISB/data/allDIAv3/interact-160611_0001_fulldia_1_q1_msgf.pep.xml
> msgf.test1.interact.ptm.pep.xml *
>
> I get many errors in the form of (also see attached text logs):
>
> WARNING: Illegal peptide found in pepXML with non-matching mass: 
> QRHKQ[129]N[115]LYGDYAFDAN[115]R
>       Neutral Mass (from pepXML) = 2080.92
>       Neutral Computed Mass for Evaluation = 2097.95
>       PPM difference = 8182.22WARNING: Illegal peptide found in pepXML with 
> non-matching mass: M[147]TISFLLR
>       Neutral Mass (from pepXML) = 1037.56
>       Neutral Computed Mass for Evaluation = 995.547
>       PPM difference = 40489.9
>
> However, these PTM prophet runs finish with error code = 0 and produce 
> pep.xml files that I can view and that have localization scores.  Is this OK?
>
> More importantly, when I run the same command on the comet output, I get 
> nothing:
>
> *EXECUTING: cd
> c:/Inetpub/wwwroot/ISB/data/allDIAv3&
> c:\Inetpub\tpp-bin\PTMProphetParser K,42.010565,M,15.994915,NQ,0.984016
> MZTOL=0.055
> c:/Inetpub/wwwroot/ISB/data/allDIAv3/interact-160611_0001_fulldia_1_q1_c.pep.xml
>  comet.test1.interact.ptm.pep.xml
> *
>
> INFO: Writing file comet.test1.interact.ptm.pep.xml ...
> INFO: Reading file 
> c:/Inetpub/wwwroot/ISB/data/allDIAv3/interact-160611_0001_fulldia_1_q1_c.pep.xml
>  ...
> *Command FAILED*
>
> RETURN CODE:65280
> I could omit the comet search results if you say that the PTMprophet results 
> for MSGF+ and X!tandem searches are OK despite the errors.
>
> Here is a link to all the relevant files on google drive:
>
> https://drive.google.com/folderview?id=0B4N83JlasjgsVVBBVDM0NGlCcTQ&usp=sharing
>
> Your help is appreciated.
>
> Best regards,
> Jesse Meyer
>
> On Thursday, May 14, 2015 at 1:47:03 PM UTC-7, David Shteynberg wrote:
>>
>> Hello Delphine,
>>
>> I have discovered the bug in Mascot2XML that was getting the masses wrong
>> in the pepXML.  You will need to reconvert from the dat file and rerun the
>> PeptideProphet Mascot analysis followed by iProphet analysis followed by
>> PTMProphet.
>>
>> The corrected Mascol2XML binary for windows can be downloaded here for
>> now:
>>
>> https://dl.dropboxusercontent.com/u/21286225/Mascot2XML.exe
>>
>> The updated version of PTMProphetParser for windows can be found here for
>> now:
>>
>> https://dl.dropboxusercontent.com/u/21286225/PTMProphetParser.exe
>>
>>
>> Backup and replace the copies you have in C:\Inetpub\tpp-bin with these
>> copies if you want to test it out.
>>
>> Thanks,
>> -David
>>
>>
>> On Fri, May 1, 2015 at 11:27 AM, David Shteynberg <
>> [email protected]> wrote:
>>
>>> Hello Delphine,
>>>
>>> I ran the new version, which gives more information.  The problem here
>>> is that MASCOT generated and reported massed in the pepXML file are not
>>> close enough to the PTMProphet computed masses.  The error is small <0.01
>>> for K methylation and is likely related to the masses used internally in
>>> MASCOT being different from those used internally by the other search
>>> engines you applied.
>>>
>>> If you can send me the dat file I can dig deeper into the MASCOT issue.
>>>
>>> Thanks,
>>> -David
>>>
>>> Here are the new  warnings:
>>>
>>> *EXECUTING: cd c:/Inetpub/wwwroot/ISB/data/Delphine&&
>>> c:\Inetpub\tpp-bin\PTMProphetParser
>>> CQ,-17.0265,M,15.995,K,14.0156,E,-18.0106,n,42.0106 MZTOL=0.2
>>> c:/Inetpub/wwwroot/ISB/data/Delphine/327_05_01_020_150417_01_MTCS_0_D_interact.iproph.pep.xml
>>> interact.ptm.pep.xml *
>>>
>>> INFO: Writing file interact.ptm.pep.xml ...
>>> INFO: Reading file 
>>> c:/Inetpub/wwwroot/ISB/data/Delphine/327_05_01_020_150417_01_MTCS_0_D_interact.iproph.pep.xml
>>>  ...WARNING: Illegal peptide found in pepXML with non-matching mass: 
>>> GTAGK[142]VIK[142]
>>>     Neutral Mass (from pepXML) = 800.52
>>>     Neutral Computed Mass for Evaluation = 800.512WARNING: Illegal peptide 
>>> found in pepXML with non-matching mass: ILVAIM[147]K[142]
>>>     Neutral Mass (from pepXML) = 816.522
>>>     Neutral Computed Mass for Evaluation = 816.514WARNING: Illegal peptide 
>>> found in pepXML with non-matching mass: VTNLHVK[142]
>>>     Neutral Mass (from pepXML) = 823.499
>>>     Neutral Computed Mass for Evaluation = 823.492WARNING: Illegal peptide 
>>> found in pepXML with non-matching mass: ALK[142]EPPR
>>>     Neutral Mass (from pepXML) = 823.499
>>>     Neutral Computed Mass for Evaluation = 823.492WARNING: Illegal peptide 
>>> found in pepXML with non-matching mass: ALK[142]EPPR
>>>     Neutral Mass (from pepXML) = 823.499
>>>     Neutral Computed Mass for Evaluation = 823.492WARNING: Illegal peptide 
>>> found in pepXML with non-matching mass: ALK[142]EPPR
>>>     Neutral Mass (from pepXML) = 823.499
>>>     Neutral Computed Mass for Evaluation = 823.492WARNING: Illegal peptide 
>>> found in pepXML with non-matching mass: K[142]EGVK[142]PR
>>>     Neutral Mass (from pepXML) = 840.526
>>>     Neutral Computed Mass for Evaluation = 840.518WARNING: Illegal peptide 
>>> found in pepXML with non-matching mass: VLEPENK[142]
>>>     Neutral Mass (from pepXML) = 841.462
>>>     Neutral Computed Mass for Evaluation = 841.455WARNING: Illegal peptide 
>>> found in pepXML with non-matching mass: VLNILEK[142]
>>>     Neutral Mass (from pepXML) = 841.535
>>>     Neutral Computed Mass for Evaluation = 841.527WARNING: Illegal peptide 
>>> found in pepXML with non-matching mass: WLVVPDK[142]
>>>     Neutral Mass (from pepXML) = 869.509
>>>     Neutral Computed Mass for Evaluation = 869.501WARNING: Illegal peptide 
>>> found in pepXML with non-matching mass: LLLTTPAK[142]
>>>     Neutral Mass (from pepXML) = 869.566
>>>     Neutral Computed Mass for Evaluation = 869.559WARNING: Illegal peptide 
>>> found in pepXML with non-matching mass: K[142]PHPPKR
>>>     Neutral Mass (from pepXML) = 872.542
>>>     Neutral Computed Mass for Evaluation = 872.534WARNING: Illegal peptide 
>>> found in pepXML with non-matching mass: KPHPPK[142]R
>>>     Neutral Mass (from pepXML) = 872.542
>>>     Neutral Computed Mass for Evaluation = 872.534WARNING: Illegal peptide 
>>> found in pepXML with non-matching mass: DADFNGTK[142]
>>>     Neutral Mass (from pepXML) = 880.4
>>>     Neutral Computed Mass for Evaluation = 880.393WARNING: Illegal peptide 
>>> found in pepXML with non-matching mass: LYSC[160]TPR
>>>     Neutral Mass (from pepXML) = 895.43
>>>     Neutral Computed Mass for Evaluation = 895.422WARNING: Illegal peptide 
>>> found in pepXML with non-matching mass: KAVVVC[160]PK
>>>     Neutral Mass (from pepXML) = 899.534
>>>     Neutral Computed Mass for Evaluation = 899.526WARNING: Illegal peptide 
>>> found in pepXML with non-matching mass: KTPM[147]C[160]EK
>>>     Neutral Mass (from pepXML) = 908.417
>>>     Neutral Computed Mass for Evaluation = 908.41WARNING: Illegal peptide 
>>> found in pepXML with non-matching mass: LAALAEALK[142]
>>>     Neutral Mass (from pepXML) = 912.572
>>>     Neutral Computed Mass for Evaluation = 912.564WARNING: Illegal peptide 
>>> found in pepXML with non-matching mass: VK[142]THLFR
>>>     Neutral Mass (from pepXML) = 913.558
>>>     Neutral Computed Mass for Evaluation = 913.55WARNING: Illegal peptide 
>>> found in pepXML with non-matching mass: M[147]EFLKQK
>>>     Neutral Mass (from pepXML) = 938.497
>>>     Neutral Computed Mass for Evaluation = 938.49WARNING: Illegal peptide 
>>> found in pepXML with non-matching mass: M[147]DK[142]TFER
>>>     Neutral Mass (from pepXML) = 955.451
>>>     Neutral Computed Mass for Evaluation = 955.443WARNING: Illegal peptide 
>>> found in pepXML with non-matching mass: GAGM[147]SFSRK
>>>     Neutral Mass (from pepXML) = 955.462
>>>     Neutral Computed Mass for Evaluation = 955.455WARNING: Illegal peptide 
>>> found in pepXML with non-matching mass: ALLVYC[160]VK
>>>     Neutral Mass (from pepXML) = 964.549
>>>     Neutral Computed Mass for Evaluation = 964.542WARNING: Illegal peptide 
>>> found in pepXML with non-matching mass: ALLVYC[160]VK
>>>     Neutral Mass (from pepXML) = 964.549
>>>     Neutral Computed Mass for Evaluation = 964.542WARNING: Illegal peptide 
>>> found in pepXML with non-matching mass: VFISC[160]K[142]VQ
>>>     Neutral Mass (from pepXML) = 993.54
>>>     Neutral Computed Mass for Evaluation = 993.532WARNING: Illegal peptide 
>>> found in pepXML with non-matching mass: VM[147]LYPSRI
>>>     Neutral Mass (from pepXML) = 993.539
>>>     Neutral Computed Mass for Evaluation = 993.532WARNING: Illegal peptide 
>>> found in pepXML with non-matching mass: M[147]C[160]GDC[160]VEK
>>>     Neutral Mass (from pepXML) = 1013.37
>>>     Neutral Computed Mass for Evaluation = 1013.36WARNING: Illegal peptide 
>>> found in pepXML with non-matching mass: LSLHLSPIK[142]
>>>     Neutral Mass (from pepXML) = 1020.64
>>>     Neutral Computed Mass for Evaluation = 1020.63WARNING: Illegal peptide 
>>> found in pepXML with non-matching mass: M[147]SVNISTAGK
>>>     Neutral Mass (from pepXML) = 1022.51
>>>     Neutral Computed Mass for Evaluation = 1022.51WARNING: Illegal peptide 
>>> found in pepXML with non-matching mass: NLMANRPAK[142]
>>>     Neutral Mass (from pepXML) = 1027.57
>>>     Neutral Computed Mass for Evaluation = 1027.56WARNING: Illegal peptide 
>>> found in pepXML with non-matching mass: TAM[147]LLALQR
>>>     Neutral Mass (from pepXML) = 1031.59
>>>     Neutral Computed Mass for Evaluation = 1031.58WARNING: Illegal peptide 
>>> found in pepXML with non-matching mass: LSSC[160]KPPKK
>>>     Neutral Mass (from pepXML) = 1043.59
>>>     Neutral Computed Mass for Evaluation = 1043.58WARNING: Illegal peptide 
>>> found in pepXML with non-matching mass: K[142]QLYPFFK
>>>     Neutral Mass (from pepXML) = 1083.62
>>>     Neutral Computed Mass for Evaluation = 1083.61WARNING: Illegal peptide 
>>> found in pepXML with non-matching mass: KQLYPFFK[142]
>>>     Neutral Mass (from pepXML) = 1083.62
>>>     Neutral Computed Mass for Evaluation = 1083.61WARNING: Illegal peptide 
>>> found in pepXML with non-matching mass: TK[142]LNYNPPK
>>>     Neutral Mass (from pepXML) = 1087.61
>>>     Neutral Computed Mass for Evaluation = 1087.6WARNING: Illegal peptide 
>>> found in pepXML with non-matching mass: TKLNYNPPK[142]
>>>     Neutral Mass (from pepXML) = 1087.61
>>>     Neutral Computed Mass for Evaluation = 1087.6WARNING: Illegal peptide 
>>> found in pepXML with non-matching mass: IIK[142]ALDLPAK
>>>     Neutral Mass (from pepXML) = 1094.71
>>>     Neutral Computed Mass for Evaluation = 1094.71WARNING: Illegal peptide 
>>> found in pepXML with non-matching mass: IIKALDLPAK[142]
>>>     Neutral Mass (from pepXML) = 1094.71
>>>     Neutral Computed Mass for Evaluation = 1094.71WARNING: Illegal peptide 
>>> found in pepXML with non-matching mass: VK[142]PNVAVLSR
>>>     Neutral Mass (from pepXML) = 1095.68
>>>     Neutral Computed Mass for Evaluation = 1095.68WARNING: Illegal peptide 
>>> found in pepXML with non-matching mass: ASSLPSSAPAVK[142]
>>>     Neutral Mass (from pepXML) = 1127.63
>>>     Neutral Computed Mass for Evaluation = 1127.62WARNING: Illegal peptide 
>>> found in pepXML with non-matching mass: SLASSAQPGLGK[142]
>>>     Neutral Mass (from pepXML) = 1128.62
>>>     Neutral Computed Mass for Evaluation = 1128.61WARNING: Illegal peptide 
>>> found in pepXML with non-matching mass: AEM[147]EELM[147]EK
>>>     Neutral Mass (from pepXML) = 1140.48
>>>     Neutral Computed Mass for Evaluation = 1140.47WARNING: Illegal peptide 
>>> found in pepXML with non-matching mass: NDC[160]TTQSNVK
>>>     Neutral Mass (from pepXML) = 1165.51
>>>     Neutral Computed Mass for Evaluation = 1165.5WARNING: Illegal peptide 
>>> found in pepXML with non-matching mass: LNK[142]TPIPQTK[142]
>>>     Neutral Mass (from pepXML) = 1166.71
>>>     Neutral Computed Mass for Evaluation = 1166.7WARNING: Illegal peptide 
>>> found in pepXML with non-matching mass: SSLLGTGITSPK[142]
>>>     Neutral Mass (from pepXML) = 1173.67
>>>     Neutral Computed Mass for Evaluation = 1173.66WARNING: Illegal peptide 
>>> found in pepXML with non-matching mass: LIDLC[160]QPTQK[142]
>>>     Neutral Mass (from pepXML) = 1228.66
>>>     Neutral Computed Mass for Evaluation = 1228.65WARNING: Illegal peptide 
>>> found in pepXML with non-matching mass: RNQDRPSLLK[142]
>>>     Neutral Mass (from pepXML) = 1239.71
>>>     Neutral Computed Mass for Evaluation = 1239.7WARNING: Illegal peptide 
>>> found in pepXML with non-matching mass: K[142]RPDEMLLPK
>>>     Neutral Mass (from pepXML) = 1239.71
>>>     Neutral Computed Mass for Evaluation = 1239.7WARNING: Illegal peptide 
>>> found in pepXML with non-matching mass: KRPDEMLLPK[142]
>>>     Neutral Mass (from pepXML) = 1239.71
>>>     Neutral Computed Mass for Evaluation = 1239.7WARNING: Illegal peptide 
>>> found in pepXML with non-matching mass: LAERPNIKM[147]R
>>>     Neutral Mass (from pepXML) = 1242.69
>>>     Neutral Computed Mass for Evaluation = 1242.69WARNING: Illegal peptide 
>>> found in pepXML with non-matching mass: K[142]ITGEIMHALK
>>>     Neutral Mass (from pepXML) = 1253.72
>>>     Neutral Computed Mass for Evaluation = 1253.72WARNING: Illegal peptide 
>>> found in pepXML with non-matching mass: KITGEIMHALK[142]
>>>     Neutral Mass (from pepXML) = 1253.72
>>>     Neutral Computed Mass for Evaluation = 1253.72WARNING: Illegal peptide 
>>> found in pepXML with non-matching mass: NVQTPQC[160]K[142]LR
>>>     Neutral Mass (from pepXML) = 1256.67
>>>     Neutral Computed Mass for Evaluation = 1256.67WARNING: Illegal peptide 
>>> found in pepXML with non-matching mass: VGAWGISGEPRK[142]
>>>     Neutral Mass (from pepXML) = 1269.69
>>>     Neutral Computed Mass for Evaluation = 1269.68WARNING: Illegal peptide 
>>> found in pepXML with non-matching mass: DLLHPSPEEEK[142]
>>>     Neutral Mass (from pepXML) = 1306.65
>>>     Neutral Computed Mass for Evaluation = 1306.64WARNING: Illegal peptide 
>>> found in pepXML with non-matching mass: GALGPGGPLGHPGEK[142]
>>>     Neutral Mass (from pepXML) = 1356.72
>>>     Neutral Computed Mass for Evaluation = 1356.71WARNING: Illegal peptide 
>>> found in pepXML with non-matching mass: KAGTVM[147]FEYGMR
>>>     Neutral Mass (from pepXML) = 1404.66
>>>     Neutral Computed Mass for Evaluation = 1404.65WARNING: Illegal peptide 
>>> found in pepXML with non-matching mass: KAGTVMFEYGM[147]R
>>>     Neutral Mass (from pepXML) = 1404.66
>>>     Neutral Computed Mass for Evaluation = 1404.65WARNING: Illegal peptide 
>>> found in pepXML with non-matching mass: REENQNEVNM[147]K
>>>     Neutral Mass (from pepXML) = 1405.63
>>>     Neutral Computed Mass for Evaluation = 1405.63WARNING: Illegal peptide 
>>> found in pepXML with non-matching mass: K[142]NSGC[160]TEVC[160]HTR
>>>     Neutral Mass (from pepXML) = 1461.65
>>>     Neutral Computed Mass for Evaluation = 1461.65WARNING: Illegal peptide 
>>> found in pepXML with non-matching mass: QILLLLPVM[147]INM[147]LK[142]
>>>     Neutral Mass (from pepXML) = 1684.01
>>>     Neutral Computed Mass for Evaluation = 1684WARNING: Illegal peptide 
>>> found in pepXML with non-matching mass: QILLLLPVM[147]INM[147]LK[142]
>>>     Neutral Mass (from pepXML) = 1684.01
>>>     Neutral Computed Mass for Evaluation = 1684WARNING: Illegal peptide 
>>> found in pepXML with non-matching mass: LQGEGLSVAGIVC[160]HVGK
>>>     Neutral Mass (from pepXML) = 1722.92
>>>     Neutral Computed Mass for Evaluation = 1722.91WARNING: Illegal peptide 
>>> found in pepXML with non-matching mass: SWAEAYK[142]DLENSDEFK[142]
>>>     Neutral Mass (from pepXML) = 1958.9
>>>     Neutral Computed Mass for Evaluation = 1958.89WARNING: Illegal peptide 
>>> found in pepXML with non-matching mass: DLVSGGSNEGNGK[142]EDWAMK[142]
>>>     Neutral Mass (from pepXML) = 2020.92
>>>     Neutral Computed Mass for Evaluation = 2020.92WARNING: Illegal peptide 
>>> found in pepXML with non-matching mass: AVATGKM[147]DENQFVAVTSTNAAK
>>>     Neutral Mass (from pepXML) = 2268.11
>>>     Neutral Computed Mass for Evaluation = 2268.11WARNING: Illegal peptide 
>>> found in pepXML with non-matching mass: LPMASSMEHGK[142]DLPSVQLLMK[142]
>>>     Neutral Mass (from pepXML) = 2339.21
>>>     Neutral Computed Mass for Evaluation = 2339.21WARNING: Illegal peptide 
>>> found in pepXML with non-matching mass: M[147]QILTPPLQSSVELVADPETR
>>>     Neutral Mass (from pepXML) = 2339.21
>>>     Neutral Computed Mass for Evaluation = 2339.2WARNING: Illegal peptide 
>>> found in pepXML with non-matching mass: LTPTEIVLILPM[147]PEQRNSLTAK[142]
>>>     Neutral Mass (from pepXML) = 2493.4
>>>     Neutral Computed Mass for Evaluation = 2493.39WARNING: Illegal peptide 
>>> found in pepXML with non-matching mass: QKLC[160]YVSQGNASFTYGYEYLGC[160]TSR
>>>     Neutral Mass (from pepXML) = 2951.33
>>>     Neutral Computed Mass for Evaluation = 2951.32WARNING: Illegal peptide 
>>> found in pepXML with non-matching mass: DNEIQMDMTLGPIEEAYAILNRFEVEVTK[142]
>>>     Neutral Mass (from pepXML) = 3381.66
>>>     Neutral Computed Mass for Evaluation = 3381.65WARNING: Illegal peptide 
>>> found in pepXML with non-matching mass: 
>>> QM[147]GQEIGNELDEQNEIIDDLANLVENTDEK[142]
>>>     Neutral Mass (from pepXML) = 3445.58
>>>     Neutral Computed Mass for Evaluation = 3445.57WARNING: Illegal peptide 
>>> found in pepXML with non-matching mass: 
>>> HLVC[160]SFRLYPFTVHTVSPGNSHLALYQVFK[142]
>>>     Neutral Mass (from pepXML) = 3530.84
>>>     Neutral Computed Mass for Evaluation = 3530.83WARNING: Illegal peptide 
>>> found in pepXML with non-matching mass: 
>>> EVK[142]VYLLTTSSAPYC[160]NAFQLLTVAPNHGISLK[142]
>>>     Neutral Mass (from pepXML) = 3561.9
>>>     Neutral Computed Mass for Evaluation = 3561.89WARNING: Illegal peptide 
>>> found in pepXML with non-matching mass: 
>>> K[142]GNFQLQGTM[147]LSDGQGFTQDDVQAAEVTYGAMAR
>>>     Neutral Mass (from pepXML) = 3663.7
>>>     Neutral Computed Mass for Evaluation = 3663.69WARNING: Illegal peptide 
>>> found in pepXML with non-matching mass: 
>>> K[142]GNFQLQGTMLSDGQGFTQDDVQAAEVTYGAM[147]AR
>>>     Neutral Mass (from pepXML) = 3663.7
>>>     Neutral Computed Mass for Evaluation = 3663.69WARNING: Illegal peptide 
>>> found in pepXML with non-matching mass: 
>>> EESLHSILAGSDM[147]TVSQILLTQHGIPVM[147]NLSDGK[142]
>>>     Neutral Mass (from pepXML) = 3665.84
>>>     Neutral Computed Mass for Evaluation = 3665.83WARNING: Illegal peptide 
>>> found in pepXML with non-matching mass: 
>>> DPPAQC[160]SAGPVGDDM[147]FHWQATIM[147]GPISNYMLDN
>>>     Neutral Mass (from pepXML) = 3666.56
>>>     Neutral Computed Mass for Evaluation = 3666.55WARNING: Illegal peptide 
>>> found in pepXML with non-matching mass: 
>>> DPPAQC[160]SAGPVGDDM[147]FHWQATIMGPISNYM[147]LDN
>>>     Neutral Mass (from pepXML) = 3666.56
>>>     Neutral Computed Mass for Evaluation = 3666.55WARNING: Illegal peptide 
>>> found in pepXML with non-matching mass: 
>>> DPPAQC[160]SAGPVGDDMFHWQATIM[147]GPISNYM[147]LDN
>>>     Neutral Mass (from pepXML) = 3666.56
>>>     Neutral Computed Mass for Evaluation = 3666.55WARNING: Illegal peptide 
>>> found in pepXML with non-matching mass: 
>>> LYC[160]NGDGEWM[147]VPIGRC[160]TC[160]K[142]PGYEPENSVAC[160]K
>>>     Neutral Mass (from pepXML) = 3676.6
>>>     Neutral Computed Mass for Evaluation = 3676.59WARNING: Illegal peptide 
>>> found in pepXML with non-matching mass: 
>>> LYC[160]NGDGEWM[147]VPIGRC[160]TC[160]KPGYEPENSVAC[160]K[142]
>>>     Neutral Mass (from pepXML) = 3676.6
>>>     Neutral Computed Mass for Evaluation = 3676.59WARNING: Illegal peptide 
>>> found in pepXML with non-matching mass: 
>>> ASVDSGNEDIIEALISLFYGVM[147]TPMLNPLIYSLR
>>>     Neutral Mass (from pepXML) = 3756.91
>>>     Neutral Computed Mass for Evaluation = 3756.9WARNING: Illegal peptide 
>>> found in pepXML with non-matching mass: 
>>> ASVDSGNEDIIEALISLFYGVMTPM[147]LNPLIYSLR
>>>     Neutral Mass (from pepXML) = 3756.91
>>>     Neutral Computed Mass for Evaluation = 3756.9WARNING: Illegal peptide 
>>> found in pepXML with non-matching mass: 
>>> M[147]GFNRPSKIQENALPLMLAEPPQNLIAQSQSGTGK
>>>     Neutral Mass (from pepXML) = 3780.94
>>>     Neutral Computed Mass for Evaluation = 3780.93WARNING: Illegal peptide 
>>> found in pepXML with non-matching mass: 
>>> MGFNRPSKIQENALPLM[147]LAEPPQNLIAQSQSGTGK
>>>     Neutral Mass (from pepXML) = 3780.94
>>>     Neutral Computed Mass for Evaluation = 3780.93WARNING: Illegal peptide 
>>> found in pepXML with non-matching mass: 
>>> GFPSQC[160]YSAQTLPELC[160]SPQDELDFLM[147]EALIISK
>>>     Neutral Mass (from pepXML) = 3802.79
>>>     Neutral Computed Mass for Evaluation = 3802.78WARNING: Illegal peptide 
>>> found in pepXML with non-matching mass: 
>>> LYTM[147]DGITVTVADLFFAGTETTSTTLRYGLLILMK[142]
>>>     Neutral Mass (from pepXML) = 3885.03
>>>     Neutral Computed Mass for Evaluation = 3885.02WARNING: Illegal peptide 
>>> found in pepXML with non-matching mass: 
>>> LYTMDGITVTVADLFFAGTETTSTTLRYGLLILM[147]K[142]
>>>     Neutral Mass (from pepXML) = 3885.03
>>>     Neutral Computed Mass for Evaluation = 3885.02WARNING: Illegal peptide 
>>> found in pepXML with non-matching mass: 
>>> FVHKSFVEVNEEGTEAAAASSC[160]FVVAEC[160]C[160]M[147]ESGPR
>>>     Neutral Mass (from pepXML) = 3906.7
>>>     Neutral Computed Mass for Evaluation = 3906.7WARNING: Illegal peptide 
>>> found in pepXML with non-matching mass: 
>>> GPLLAQEM[147]PTVSVLEYALPQRPPQGPEDDRDLSER
>>>     Neutral Mass (from pepXML) = 3918.95
>>>     Neutral Computed Mass for Evaluation = 3918.94
>>>
>>> *Command Successful*
>>> RETURN CODE:0
>>>
>>>
>>>
>>>
>>> On Thu, Apr 30, 2015 at 2:18 AM, delphine wood <[email protected]> wrote:
>>>
>>>> Hi,
>>>>
>>>> I send you the mzxml file through wetransfer.
>>>> I tried with this command
>>>> * /opt/tpp/bin/PTMProphetParser STY,79.966,K,14.0156,M,15.995 MZTOL=0.2
>>>> /opt/tpp/data/327_05_01/327_05_01_020_150417_01_MTCS_0_D_interact.iproph.pep.xml
>>>> interact.ptm.pep.xml *
>>>>
>>>> I got these warnings:
>>>>
>>>> INFO: Writing file interact.ptm.pep.xml ...
>>>> INFO: Reading file 
>>>> /opt/tpp/data/327_05_01/327_05_01_020_150417_01_MTCS_0_D_interact.iproph.pep.xml
>>>>  ...WARNING: Illegal peptide with unknown mod: GTAGK[142]VIK[142]WARNING: 
>>>> Illegal peptide with unknown mod: ILVAIM[147]K[142]WARNING: Illegal 
>>>> peptide with unknown mod: VTNLHVK[142]WARNING: Illegal peptide with 
>>>> unknown mod: ALK[142]EPPRWARNING: Illegal peptide with unknown mod: 
>>>> ALK[142]EPPRWARNING: Illegal peptide with unknown mod: 
>>>> ALK[142]EPPRWARNING: Illegal peptide with unknown mod: 
>>>> K[142]EGVK[142]PRWARNING: Illegal peptide with unknown mod: 
>>>> VLEPENK[142]WARNING: Illegal peptide with unknown mod: 
>>>> VLNILEK[142]WARNING: Illegal peptide with unknown mod: 
>>>> WLVVPDK[142]WARNING: Illegal peptide with unknown mod: 
>>>> LLLTTPAK[142]WARNING: Illegal peptide with unknown mod: 
>>>> K[142]PHPPKRWARNING: Illegal peptide with unknown mod: 
>>>> KPHPPK[142]RWARNING: Illegal peptide with unknown mod: 
>>>> DADFNGTK[142]WARNING: Illegal peptide with unknown mod: 
>>>> LYSC[160]TPRWARNING: Illegal peptide with unknown mod: 
>>>> KAVVVC[160]PKWARNING: Illegal peptide with unknown mod: 
>>>> KTPM[147]C[160]EKWARNING: Illegal peptide with unknown mod: 
>>>> LAALAEALK[142]WARNING: Illegal peptide with unknown mod: 
>>>> VK[142]THLFRWARNING: Illegal peptide with unknown mod: 
>>>> M[147]EFLKQKWARNING: Illegal peptide with unknown mod: 
>>>> M[147]DK[142]TFERWARNING: Illegal peptide with unknown mod: 
>>>> GAGM[147]SFSRKWARNING: Illegal peptide with unknown mod: 
>>>> ALLVYC[160]VKWARNING: Illegal peptide with unknown mod: 
>>>> ALLVYC[160]VKWARNING: Illegal peptide with unknown mod: 
>>>> VFISC[160]K[142]VQWARNING: Illegal peptide with unknown mod: 
>>>> VM[147]LYPSRIWARNING: Illegal peptide with unknown mod: 
>>>> M[147]C[160]GDC[160]VEKWARNING: Illegal peptide with unknown mod: 
>>>> LSLHLSPIK[142]WARNING: Illegal peptide with unknown mod: 
>>>> M[147]SVNISTAGKWARNING: Illegal peptide with unknown mod: 
>>>> NLMANRPAK[142]WARNING: Illegal peptide with unknown mod: 
>>>> TAM[147]LLALQRWARNING: Illegal peptide with unknown mod: 
>>>> LSSC[160]KPPKKWARNING: Illegal peptide with unknown mod: 
>>>> K[142]QLYPFFKWARNING: Illegal peptide with unknown mod: 
>>>> KQLYPFFK[142]WARNING: Illegal peptide with unknown mod: 
>>>> TK[142]LNYNPPKWARNING: Illegal peptide with unknown mod: 
>>>> TKLNYNPPK[142]WARNING: Illegal peptide with unknown mod: 
>>>> IIK[142]ALDLPAKWARNING: Illegal peptide with unknown mod: 
>>>> IIKALDLPAK[142]WARNING: Illegal peptide with unknown mod: 
>>>> VK[142]PNVAVLSRWARNING: Illegal peptide with unknown mod: 
>>>> ASSLPSSAPAVK[142]WARNING: Illegal peptide with unknown mod: 
>>>> SLASSAQPGLGK[142]WARNING: Illegal peptide with unknown mod: 
>>>> AEM[147]EELM[147]EKWARNING: Illegal peptide with unknown mod: 
>>>> NDC[160]TTQSNVKWARNING: Illegal peptide with unknown mod: 
>>>> LNK[142]TPIPQTK[142]WARNING: Illegal peptide with unknown mod: 
>>>> SSLLGTGITSPK[142]WARNING: Illegal peptide with unknown mod: 
>>>> LIDLC[160]QPTQK[142]WARNING: Illegal peptide with unknown mod: 
>>>> RNQDRPSLLK[142]WARNING: Illegal peptide with unknown mod: 
>>>> K[142]RPDEMLLPKWARNING: Illegal peptide with unknown mod: 
>>>> KRPDEMLLPK[142]WARNING: Illegal peptide with unknown mod: 
>>>> LAERPNIKM[147]RWARNING: Illegal peptide with unknown mod: 
>>>> K[142]ITGEIMHALKWARNING: Illegal peptide with unknown mod: 
>>>> KITGEIMHALK[142]WARNING: Illegal peptide with unknown mod: 
>>>> NVQTPQC[160]K[142]LRWARNING: Illegal peptide with unknown mod: 
>>>> VGAWGISGEPRK[142]WARNING: Illegal peptide with unknown mod: 
>>>> DLLHPSPEEEK[142]WARNING: Illegal peptide with unknown mod: 
>>>> GALGPGGPLGHPGEK[142]WARNING: Illegal peptide with unknown mod: 
>>>> KAGTVM[147]FEYGMRWARNING: Illegal peptide with unknown mod: 
>>>> KAGTVMFEYGM[147]RWARNING: Illegal peptide with unknown mod: 
>>>> REENQNEVNM[147]KWARNING: Illegal peptide with unknown mod: 
>>>> K[142]NSGC[160]TEVC[160]HTRWARNING: Illegal peptide with unknown mod: 
>>>> QILLLLPVM[147]INM[147]LK[142]WARNING: Illegal peptide with unknown mod: 
>>>> QILLLLPVM[147]INM[147]LK[142]WARNING: Illegal peptide with unknown mod: 
>>>> LQGEGLSVAGIVC[160]HVGKWARNING: Illegal peptide with unknown mod: 
>>>> SWAEAYK[142]DLENSDEFK[142]WARNING: Illegal peptide with unknown mod: 
>>>> DLVSGGSNEGNGK[142]EDWAMK[142]WARNING: Illegal peptide with unknown mod: 
>>>> AVATGKM[147]DENQFVAVTSTNAAKWARNING: Illegal peptide with unknown mod: 
>>>> LPMASSMEHGK[142]DLPSVQLLMK[142]WARNING: Illegal peptide with unknown mod: 
>>>> M[147]QILTPPLQSSVELVADPETRWARNING: Illegal peptide with unknown mod: 
>>>> LTPTEIVLILPM[147]PEQRNSLTAK[142]WARNING: Illegal peptide with unknown mod: 
>>>> QKLC[160]YVSQGNASFTYGYEYLGC[160]TSRWARNING: Illegal peptide with unknown 
>>>> mod: DNEIQMDMTLGPIEEAYAILNRFEVEVTK[142]WARNING: Illegal peptide with 
>>>> unknown mod: QM[147]GQEIGNELDEQNEIIDDLANLVENTDEK[142]WARNING: Illegal 
>>>> peptide with unknown mod: HLVC[160]SFRLYPFTVHTVSPGNSHLALYQVFK[142]WARNING: 
>>>> Illegal peptide with unknown mod: 
>>>> EVK[142]VYLLTTSSAPYC[160]NAFQLLTVAPNHGISLK[142]WARNING: Illegal peptide 
>>>> with unknown mod: K[142]GNFQLQGTM[147]LSDGQGFTQDDVQAAEVTYGAMARWARNING: 
>>>> Illegal peptide with unknown mod: 
>>>> K[142]GNFQLQGTMLSDGQGFTQDDVQAAEVTYGAM[147]ARWARNING: Illegal peptide with 
>>>> unknown mod: EESLHSILAGSDM[147]TVSQILLTQHGIPVM[147]NLSDGK[142]WARNING: 
>>>> Illegal peptide with unknown mod: 
>>>> DPPAQC[160]SAGPVGDDM[147]FHWQATIM[147]GPISNYMLDNWARNING: Illegal peptide 
>>>> with unknown mod: DPPAQC[160]SAGPVGDDM[147]FHWQATIMGPISNYM[147]LDNWARNING: 
>>>> Illegal peptide with unknown mod: 
>>>> DPPAQC[160]SAGPVGDDMFHWQATIM[147]GPISNYM[147]LDNWARNING: Illegal peptide 
>>>> with unknown mod: 
>>>> LYC[160]NGDGEWM[147]VPIGRC[160]TC[160]K[142]PGYEPENSVAC[160]KWARNING: 
>>>> Illegal peptide with unknown mod: 
>>>> LYC[160]NGDGEWM[147]VPIGRC[160]TC[160]KPGYEPENSVAC[160]K[142]WARNING: 
>>>> Illegal peptide with unknown mod: 
>>>> ASVDSGNEDIIEALISLFYGVM[147]TPMLNPLIYSLRWARNING: Illegal peptide with 
>>>> unknown mod: ASVDSGNEDIIEALISLFYGVMTPM[147]LNPLIYSLRWARNING: Illegal 
>>>> peptide with unknown mod: M[147]GFNRPSKIQENALPLMLAEPPQNLIAQSQSGTGKWARNING: 
>>>> Illegal peptide with unknown mod: 
>>>> MGFNRPSKIQENALPLM[147]LAEPPQNLIAQSQSGTGKWARNING: Illegal peptide with 
>>>> unknown mod: GFPSQC[160]YSAQTLPELC[160]SPQDELDFLM[147]EALIISKWARNING: 
>>>> Illegal peptide with unknown mod: 
>>>> LYTM[147]DGITVTVADLFFAGTETTSTTLRYGLLILMK[142]WARNING: Illegal peptide with 
>>>> unknown mod: LYTMDGITVTVADLFFAGTETTSTTLRYGLLILM[147]K[142]WARNING: Illegal 
>>>> peptide with unknown mod: 
>>>> FVHKSFVEVNEEGTEAAAASSC[160]FVVAEC[160]C[160]M[147]ESGPRWARNING: Illegal 
>>>> peptide with unknown mod: GPLLAQEM[147]PTVSVLEYALPQRPPQGPEDDRDLSER
>>>> Failed to open input file 
>>>> '/opt/tpp/data/327_05_01/spectrast/327_05_01_020_150417_01.mzXML'.ERROR: 
>>>> cannot read scan in data file 
>>>> /opt/tpp/data/327_05_01/spectrast/327_05_01_020_150417_01.mzXML exiting ...
>>>>
>>>>
>>>> There is an error at the end. I don't understand why it is looking for
>>>> the mzxml file in the spectrast folder... Thus I copied the mzxml file to
>>>> the spectrast folder and it seems to work.
>>>> Could you please check if the latest PTMprophet version gives the same
>>>> warnings?
>>>>
>>>> Thanks for your help :-)
>>>>
>>>> Delphine
>>>>
>>>> 2015-04-29 19:30 GMT+02:00 David Shteynberg <
>>>> [email protected]>:
>>>>
>>>>> Hi,
>>>>>
>>>>> There may be several things going on here, which will require a new
>>>>> copy of PTMProphet for you to process the results.  I think that you are
>>>>> using an older version of PTMProphet which has seen recent improvements to
>>>>> cover more PTM user cases.  PTMProphet compares the internally calculated
>>>>> mass to the search engine reported mass, these may not agree and cause 
>>>>> this
>>>>> problem for the K[142] peptides.  The other peptides are M containing with
>>>>> oxidized Methionine so you PTMProphet settings should include M,15.9949 to
>>>>> make those go away.  If you also send the mzXML file, I can try the latest
>>>>> code on you data.
>>>>>
>>>>>
>>>>> Thanks,
>>>>> -David
>>>>>
>>>>> On Wed, Apr 29, 2015 at 8:16 AM, Delphine <[email protected]> wrote:
>>>>>
>>>>>> Hello,
>>>>>>
>>>>>> I'm trying to use ptmprophet to identify methylation on lysines.
>>>>>> First I identify the peptides with comet, xtandem, spectraST and mascot.
>>>>>> Here are the lines where the modification is discribed in the xtandem and
>>>>>> comet parameter files I used:
>>>>>>  comet: variable_mod02 = 14.015650 K 0 3 -1 0
>>>>>>  xtandem: <note type="input" label="residue, potential modification
>>>>>> mass">15.994915@M,14.015650@K</note>
>>>>>>
>>>>>> I combine the 4 results with iprophet (file joined)  and tried to use
>>>>>> PTMprophet on this file.
>>>>>>
>>>>>> Here is the command line:
>>>>>> * cd /opt/tpp/data/327_05_01; /opt/tpp/bin/PTMProphetParser K,14.0156
>>>>>> MZTOL=0.2
>>>>>> /opt/tpp/data/327_05_01/327_05_01_020_150417_01_MTCS_0_D_interact.iproph.pep.xml
>>>>>> interact.ptm.pep.xml *
>>>>>>
>>>>>> And here is the error message:
>>>>>>
>>>>>> INFO: Writing file interact.ptm.pep.xml ...
>>>>>> INFO: Reading file 
>>>>>> /opt/tpp/data/327_05_01/327_05_01_020_150417_01_MTCS_0_D_interact.iproph.pep.xml
>>>>>>  ...WARNING: Illegal peptide with unknown mod: 
>>>>>> GTAGK[142]VIK[142]WARNING: Illegal peptide with unknown mod: 
>>>>>> ILVAIMK[142]WARNING: Illegal peptide with unknown mod: 
>>>>>> VTNLHVK[142]WARNING: Illegal peptide with unknown mod: 
>>>>>> ALK[142]EPPRWARNING: Illegal peptide with unknown mod: 
>>>>>> ALK[142]EPPRWARNING: Illegal peptide with unknown mod: 
>>>>>> ALK[142]EPPRWARNING: Illegal peptide with unknown mod: 
>>>>>> K[142]EGVK[142]PRWARNING: Illegal peptide with unknown mod: 
>>>>>> VLEPENK[142]WARNING: Illegal peptide with unknown mod: 
>>>>>> VLNILEK[142]WARNING: Illegal peptide with unknown mod: 
>>>>>> WLVVPDK[142]WARNING: Illegal peptide with unknown mod: 
>>>>>> LLLTTPAK[142]WARNING: Illegal peptide with unknown mod: 
>>>>>> K[142]PHPPKRWARNING: Illegal peptide with unknown mod: 
>>>>>> KPHPPK[142]RWARNING: Illegal peptide with unknown mod: 
>>>>>> DADFNGTK[142]WARNING: Illegal peptide with unknown mod: 
>>>>>> LYSC[160]TPRWARNING: Illegal peptide with unknown mod: 
>>>>>> KAVVVC[160]PKWARNING: Illegal peptide with unknown mod: 
>>>>>> KTPMC[160]EKWARNING: Illegal peptide with unknown mod: 
>>>>>> LAALAEALK[142]WARNING: Illegal peptide with unknown mod: 
>>>>>> VK[142]THLFRWARNING: Illegal peptide with unknown mod: MEFLKQKWARNING: 
>>>>>> Illegal peptide with unknown mod: MDK[142]TFERWARNING: Illegal peptide 
>>>>>> with unknown mod: GAGMSFSRKWARNING: Illegal peptide with unknown mod: 
>>>>>> ALLVYC[160]VKWARNING: Illegal peptide with unknown mod: 
>>>>>> ALLVYC[160]VKWARNING: Illegal peptide with unknown mod: 
>>>>>> VFISC[160]K[142]VQWARNING: Illegal peptide with unknown mod: 
>>>>>> VMLYPSRIWARNING: Illegal peptide with unknown mod: 
>>>>>> MC[160]GDC[160]VEKWARNING: Illegal peptide with unknown mod: 
>>>>>> LSLHLSPIK[142]WARNING: Illegal peptide with unknown mod: 
>>>>>> MSVNISTAGKWARNING: Illegal peptide with unknown mod: 
>>>>>> NLMANRPAK[142]WARNING: Illegal peptide with unknown mod: 
>>>>>> TAMLLALQRWARNING: Illegal peptide with unknown mod: 
>>>>>> LSSC[160]KPPKKWARNING: Illegal peptide with unknown mod: 
>>>>>> K[142]QLYPFFKWARNING: Illegal peptide with unknown mod: 
>>>>>> KQLYPFFK[142]WARNING: Illegal peptide with unknown mod: 
>>>>>> TK[142]LNYNPPKWARNING: Illegal peptide with unknown mod: 
>>>>>> TKLNYNPPK[142]WARNING: Illegal peptide with unknown mod: 
>>>>>> IIK[142]ALDLPAKWARNING: Illegal peptide with unknown mod: 
>>>>>> IIKALDLPAK[142]WARNING: Illegal peptide with unknown mod: 
>>>>>> VK[142]PNVAVLSRWARNING: Illegal peptide with unknown mod: 
>>>>>> ASSLPSSAPAVK[142]WARNING: Illegal peptide with unknown mod: 
>>>>>> SLASSAQPGLGK[142]WARNING: Illegal peptide with unknown mod: 
>>>>>> AEMEELMEKWARNING: Illegal peptide with unknown mod: 
>>>>>> NDC[160]TTQSNVKWARNING: Illegal peptide with unknown mod: 
>>>>>> LNK[142]TPIPQTK[142]WARNING: Illegal peptide with unknown mod: 
>>>>>> SSLLGTGITSPK[142]WARNING: Illegal peptide with unknown mod: 
>>>>>> LIDLC[160]QPTQK[142]WARNING: Illegal peptide with unknown mod: 
>>>>>> RNQDRPSLLK[142]WARNING: Illegal peptide with unknown mod: 
>>>>>> K[142]RPDEMLLPKWARNING: Illegal peptide with unknown mod: 
>>>>>> KRPDEMLLPK[142]WARNING: Illegal peptide with unknown mod: 
>>>>>> LAERPNIKMRWARNING: Illegal peptide with unknown mod: 
>>>>>> K[142]ITGEIMHALKWARNING: Illegal peptide with unknown mod: 
>>>>>> KITGEIMHALK[142]WARNING: Illegal peptide with unknown mod: 
>>>>>> NVQTPQC[160]K[142]LRWARNING: Illegal peptide with unknown mod: 
>>>>>> VGAWGISGEPRK[142]WARNING: Illegal peptide with unknown mod: 
>>>>>> DLLHPSPEEEK[142]WARNING: Illegal peptide with unknown mod: 
>>>>>> GALGPGGPLGHPGEK[142]WARNING: Illegal peptide with unknown mod: 
>>>>>> KAGTVMFEYGMRWARNING: Illegal peptide with unknown mod: 
>>>>>> REENQNEVNMKWARNING: Illegal peptide with unknown mod: 
>>>>>> K[142]NSGC[160]TEVC[160]HTRWARNING: Illegal peptide with unknown mod: 
>>>>>> QILLLLPVMINMLK[142]WARNING: Illegal peptide with unknown mod: 
>>>>>> QILLLLPVMINMLK[142]WARNING: Illegal peptide with unknown mod: 
>>>>>> LQGEGLSVAGIVC[160]HVGKWARNING: Illegal peptide with unknown mod: 
>>>>>> SWAEAYK[142]DLENSDEFK[142]WARNING: Illegal peptide with unknown mod: 
>>>>>> DLVSGGSNEGNGK[142]EDWAMK[142]WARNING: Illegal peptide with unknown mod: 
>>>>>> AVATGKMDENQFVAVTSTNAAKWARNING: Illegal peptide with unknown mod: 
>>>>>> LPMASSMEHGK[142]DLPSVQLLMK[142]WARNING: Illegal peptide with unknown 
>>>>>> mod: MQILTPPLQSSVELVADPETRWARNING: Illegal peptide with unknown mod: 
>>>>>> LTPTEIVLILPMPEQRNSLTAK[142]WARNING: Illegal peptide with unknown mod: 
>>>>>> QKLC[160]YVSQGNASFTYGYEYLGC[160]TSRWARNING: Illegal peptide with unknown 
>>>>>> mod: DNEIQMDMTLGPIEEAYAILNRFEVEVTK[142]WARNING: Illegal peptide with 
>>>>>> unknown mod: QMGQEIGNELDEQNEIIDDLANLVENTDEK[142]WARNING: Illegal peptide 
>>>>>> with unknown mod: HLVC[160]SFRLYPFTVHTVSPGNSHLALYQVFK[142]WARNING: 
>>>>>> Illegal peptide with unknown mod: 
>>>>>> EVK[142]VYLLTTSSAPYC[160]NAFQLLTVAPNHGISLK[142]WARNING: Illegal peptide 
>>>>>> with unknown mod: K[142]GNFQLQGTMLSDGQGFTQDDVQAAEVTYGAMARWARNING: 
>>>>>> Illegal peptide with unknown mod: 
>>>>>> EESLHSILAGSDMTVSQILLTQHGIPVMNLSDGK[142]WARNING: Illegal peptide with 
>>>>>> unknown mod: DPPAQC[160]SAGPVGDDMFHWQATIMGPISNYMLDNWARNING: Illegal 
>>>>>> peptide with unknown mod: 
>>>>>> LYC[160]NGDGEWMVPIGRC[160]TC[160]K[142]PGYEPENSVAC[160]KWARNING: Illegal 
>>>>>> peptide with unknown mod: 
>>>>>> LYC[160]NGDGEWMVPIGRC[160]TC[160]KPGYEPENSVAC[160]K[142]WARNING: Illegal 
>>>>>> peptide with unknown mod: ASVDSGNEDIIEALISLFYGVMTPMLNPLIYSLRWARNING: 
>>>>>> Illegal peptide with unknown mod: 
>>>>>> MGFNRPSKIQENALPLMLAEPPQNLIAQSQSGTGKWARNING: Illegal peptide with unknown 
>>>>>> mod: GFPSQC[160]YSAQTLPELC[160]SPQDELDFLMEALIISKWARNING: Illegal peptide 
>>>>>> with unknown mod: LYTMDGITVTVADLFFAGTETTSTTLRYGLLILMK[142]WARNING: 
>>>>>> Illegal peptide with unknown mod: 
>>>>>> FVHKSFVEVNEEGTEAAAASSC[160]FVVAEC[160]C[160]MESGPRWARNING: Illegal 
>>>>>> peptide with unknown mod: GPLLAQEMPTVSVLEYALPQRPPQGPEDDRDLSERWARNING: 
>>>>>> Illegal peptide with unknown mod: GGEC[160]HGMDAEQEMRWARNING: Illegal 
>>>>>> peptide with unknown mod: WAAVMVPSGEEQRWARNING: Illegal peptide with 
>>>>>> unknown mod: MTSMMC[160]TVMLK[142]TWARNING: Illegal peptide with unknown 
>>>>>> mod: MSFSEMNRWARNING: Illegal peptide with unknown mod: 
>>>>>> MSFAGTVAWMAPEVIRWARNING: Illegal peptide with unknown mod: 
>>>>>> GSQDFSFREIMGSRWARNING: Illegal peptide with unknown mod: 
>>>>>> RAVGIWHC[160]GSC[160]MKWARNING: Illegal peptide with unknown mod: 
>>>>>> RAVGIWHC[160]GSC[160]MKWARNING: Illegal peptide with unknown mod: 
>>>>>> EMSEEMDK[142]WARNING: Illegal peptide with unknown mod: 
>>>>>> RAVGIWHC[160]GSC[160]MKWARNING: Illegal peptide with unknown mod: 
>>>>>> MVLLAGTGPEGGGARWARNING: Illegal peptide with unknown mod: 
>>>>>> QDFNMMEQRK[142]WARNING: Illegal peptide with unknown mod: 
>>>>>> MEAMGEWNPNVKWARNING: Illegal peptide with unknown mod: 
>>>>>> AVGIWHC[160]GSC[160]MKWARNING: Illegal peptide with unknown mod: 
>>>>>> TK[142]EMDVYGITDKWARNING: Illegal peptide with unknown mod: 
>>>>>> TKEMDVYGITDK[142]WARNING: Illegal peptide with unknown mod: 
>>>>>> RAVGIWHC[160]GSC[160]MKWARNING: Illegal peptide with unknown mod: 
>>>>>> RAVGIWHC[160]GSC[160]MKWARNING: Illegal peptide with unknown mod: 
>>>>>> VMAMAIDYRWARNING: Illegal peptide with unknown mod: 
>>>>>> RAVGIWHC[160]GSC[160]MKWARNING: Illegal peptide with unknown mod: 
>>>>>> AVGIWHC[160]GSC[160]MKWARNING: Illegal peptide with unknown mod: 
>>>>>> AVGIWHC[160]GSC[160]MKWARNING: Illegal peptide with unknown mod: 
>>>>>> RAVGIWHC[160]GSC[160]MKWARNING: Illegal peptide with unknown mod: 
>>>>>> IKFEMEQNLRWARNING: Illegal peptide with unknown mod: MNGLRNKWARNING: 
>>>>>> Illegal peptide with unknown mod: RAVGIWHC[160]GSC[160]MKWARNING: 
>>>>>> Illegal peptide with unknown mod: AVGIWHC[160]GSC[160]MKWARNING: Illegal 
>>>>>> peptide with unknown mod: AVGIWHC[160]GSC[160]MKWARNING: Illegal peptide 
>>>>>> with unknown mod: AVGIWHC[160]GSC[160]MKWARNING: Illegal peptide with 
>>>>>> unknown mod: RAVGIWHC[160]GSC[160]MKWARNING: Illegal peptide with 
>>>>>> unknown mod: VMLYPSRWARNING: Illegal peptide with unknown mod: 
>>>>>> RAVGIWHC[160]GSC[160]MKWARNING: Illegal peptide with unknown mod: 
>>>>>> VMLYPSRWARNING: Illegal peptide with unknown mod: KLIMEAMKWARNING: 
>>>>>> Illegal peptide with unknown mod: MC[160]GDC[160]VEKWARNING: Illegal 
>>>>>> peptide with unknown mod: SESMDYSRWARNING: Illegal peptide with unknown 
>>>>>> mod: GMPGGRNLYKWARNING: Illegal peptide with unknown mod: 
>>>>>> AVGIWHC[160]GSC[160]MKWARNING: Illegal peptide with unknown mod: 
>>>>>> RAVGIWHC[160]GSC[160]MKWARNING: Illegal peptide with unknown mod: 
>>>>>> MNAFYDAQVEFVKWARNING: Illegal peptide with unknown mod: 
>>>>>> IITVMSMGMKWARNING: Illegal peptide with unknown mod: LNIFDMMAVTKWARNING: 
>>>>>> Illegal peptide with unknown mod: RAVGIWHC[160]GSC[160]MKWARNING: 
>>>>>> Illegal peptide with unknown mod: DVDNAYMIKWARNING: Illegal peptide with 
>>>>>> unknown mod: RAVGIWHC[160]GSC[160]MKWARNING: Illegal peptide with 
>>>>>> unknown mod: MNWENESSPKWARNING: Illegal peptide with unknown mod: 
>>>>>> LNIFDMMAVTKWARNING: Illegal peptide with unknown mod: 
>>>>>> YYADGEDAYAMKWARNING: Illegal peptide with unknown mod: APAMFNIRWARNING: 
>>>>>> Illegal peptide with unknown mod: RAVGIWHC[160]GSC[160]MKWARNING: 
>>>>>> Illegal peptide with unknown mod: APAMFNIRWARNING: Illegal peptide with 
>>>>>> unknown mod: GFMVQTGDPTGTGRWARNING: Illegal peptide with unknown mod: 
>>>>>> RAVGIWHC[160]GSC[160]MKWARNING: Illegal peptide with unknown mod: 
>>>>>> MTLDDFRWARNING: Illegal peptide with unknown mod: 
>>>>>> RAVGIWHC[160]GSC[160]MKWARNING: Illegal peptide with unknown mod: 
>>>>>> RAVGIWHC[160]GSC[160]MKWARNING: Illegal peptide with unknown mod: 
>>>>>> QVLDNLTMEKWARNING: Illegal peptide with unknown mod: QVLDNLTMEKWARNING: 
>>>>>> Illegal peptide with unknown mod: RAVGIWHC[160]GSC[160]MKWARNING: 
>>>>>> Illegal peptide with unknown mod: RAVGIWHC[160]GSC[160]MKWARNING: 
>>>>>> Illegal peptide with unknown mod: QVLDNLTMEKWARNING: Illegal peptide 
>>>>>> with unknown mod: NTPGFMYK[142]WARNING: Illegal peptide with unknown 
>>>>>> mod: RAVGIWHC[160]GSC[160]MKWARNING: Illegal peptide with unknown mod: 
>>>>>> RAVGIWHC[160]GSC[160]MKWARNING: Illegal peptide with unknown mod: 
>>>>>> RAVGIWHC[160]GSC[160]MKWARNING: Illegal peptide with unknown mod: 
>>>>>> EGMLMMMSPSPRWARNING: Illegal peptide with unknown mod: 
>>>>>> RAVGIWHC[160]GSC[160]MKWARNING: Illegal peptide with unknown mod: 
>>>>>> RAVGIWHC[160]GSC[160]MKWARNING: Illegal peptide with unknown mod: 
>>>>>> RAVGIWHC[160]GSC[160]MKWARNING: Illegal peptide with unknown mod: 
>>>>>> K[142]ALMPPVKWARNING: Illegal peptide with unknown mod: 
>>>>>> KALMPPVK[142]WARNING: Illegal peptide with unknown mod: 
>>>>>> K[142]PVMPK[142]KWARNING: Illegal peptide with unknown mod: 
>>>>>> K[142]PVMPKK[142]WARNING: Illegal peptide with unknown mod: 
>>>>>> KPVMPK[142]K[142]WARNING: Illegal peptide with unknown mod: 
>>>>>> K[142]PVMPK[142]KWARNING: Illegal peptide with unknown mod: 
>>>>>> K[142]PVMPKK[142]WARNING: Illegal peptide with unknown mod: 
>>>>>> KPVMPK[142]K[142]WARNING: Illegal peptide with unknown mod: 
>>>>>> VTMQK[142]SDDVLHDLGQKWARNING: Illegal peptide with unknown mod: 
>>>>>> VTMQKSDDVLHDLGQK[142]WARNING: Illegal peptide with unknown mod: 
>>>>>> VMLYPSRIWARNING: Illegal peptide with unknown mod: VMLYPSRIWARNING: 
>>>>>> Illegal peptide with unknown mod: VMLYPSRIWARNING: Illegal peptide with 
>>>>>> unknown mod: VMLYPSRIWARNING: Illegal peptide with unknown mod: 
>>>>>> MAGGLFAVSKKWARNING: Illegal peptide with unknown mod: 
>>>>>> IGQQLGMTFISVGHRWARNING: Illegal peptide with unknown mod: 
>>>>>> VMLYPSRIWARNING: Illegal peptide with unknown mod: VMLYPSRIWARNING: 
>>>>>> Illegal peptide with unknown mod: K[142]PVMPK[142]KWARNING: Illegal 
>>>>>> peptide with unknown mod: K[142]PVMPKK[142]WARNING: Illegal peptide with 
>>>>>> unknown mod: KPVMPK[142]K[142]WARNING: Illegal peptide with unknown mod: 
>>>>>> VMLYPSRIWARNING: Illegal peptide with unknown mod: 
>>>>>> LEVVAIFGSVQMAMSRIINLHHHRWARNING: Illegal peptide with unknown mod: 
>>>>>> GLIFYDTKVTVMNRWARNING: Illegal peptide with unknown mod: 
>>>>>> LK[142]LSHLVQYEELPDYIMVMVANK[142]WARNING: Illegal peptide with unknown 
>>>>>> mod: AVLVDLEPGTMDSVRWARNING: Illegal peptide with unknown mod: 
>>>>>> AVLVDLEPGTMDSVRWARNING: Illegal peptide with unknown mod: TMADQQARR
>>>>>>  WARNING: Unrecognized mod on peptide: TVVGQITVDM[147]WARNING: Cannot 
>>>>>> initialize for sequence: TVVGQITVDM[147], unknown mods may exist in 
>>>>>> spectrum 327_05_01_020_150417_01.05584.05584.2
>>>>>> Segmentation fault
>>>>>>
>>>>>>
>>>>>> I am not very familliar with the search of PTM....
>>>>>> Thanks in advance for your help!
>>>>>>
>>>>>> Delphine
>>>>>>
>>>>>> --
>>>>>> You received this message because you are subscribed to the Google
>>>>>> Groups "spctools-discuss" group.
>>>>>> To unsubscribe from this group and stop receiving emails from it,
>>>>>> send an email to [email protected].
>>>>>> To post to this group, send email to [email protected].
>>>>>> Visit this group at http://groups.google.com/group/spctools-discuss.
>>>>>> For more options, visit https://groups.google.com/d/optout.
>>>>>>
>>>>>
>>>>> --
>>>>> You received this message because you are subscribed to a topic in the
>>>>> Google Groups "spctools-discuss" group.
>>>>> To unsubscribe from this topic, visit
>>>>> https://groups.google.com/d/topic/spctools-discuss/Af65TfANAl0/unsubscribe
>>>>> .
>>>>> To unsubscribe from this group and all its topics, send an email to
>>>>> [email protected].
>>>>> To post to this group, send email to [email protected].
>>>>> Visit this group at http://groups.google.com/group/spctools-discuss.
>>>>> For more options, visit https://groups.google.com/d/optout.
>>>>>
>>>>
>>>>
>>>
>> --
> You received this message because you are subscribed to the Google Groups
> "spctools-discuss" group.
> To unsubscribe from this group and stop receiving emails from it, send an
> email to [email protected].
> To post to this group, send email to [email protected].
> Visit this group at https://groups.google.com/group/spctools-discuss.
>
> For more options, visit https://groups.google.com/d/optout.
>

-- 
You received this message because you are subscribed to the Google Groups 
"spctools-discuss" group.
To unsubscribe from this group and stop receiving emails from it, send an email 
to [email protected].
To post to this group, send email to [email protected].
Visit this group at https://groups.google.com/group/spctools-discuss.
For more options, visit https://groups.google.com/d/optout.

Reply via email to