If you specify this mod also in the command it should process fine.

Cheers,
-David

On Wed, Jul 20, 2016 at 4:25 PM, Jesse <[email protected]> wrote:

> The error in my above post is definitely due to allowing variable
> deamidation and then tandem looking for pyro-glutamate at the same time. I
> don't really need to search for deamidation, so I think I'm all good.
>
> Thanks again,
> Jesse Meyer
>
> On Wednesday, July 20, 2016 at 3:25:38 PM UTC-7, Jesse wrote:
>
>> Hello David,
>>
>> Thanks for the quick reply as always.
>>
>> It runs fine for me with the MSGF+ results as you stated, but now neither
>> the tandem or comet results run at all.  Both give the following error:
>>
>>
>> *EXECUTING: cd c:/Inetpub/wwwroot/ISB/data/allDIAv3&
>> c:\Inetpub\tpp-bin\PTMProphetParser K,42.010565,M,15.994915,NQ,0.984016
>> MZTOL=0.1
>> c:/Inetpub/wwwroot/ISB/data/allDIAv3/interact-160611_0001_fulldia_1_q1.pep.xml
>> interact.ptm.pep.xml *
>>
>> WARN: deprecated format used to specify modifications 
>> (K,42.010565,M,15.994915,NQ,0.984016). Please see usage statement for more 
>> information.
>> INFO: Writing file interact.ptm.pep.xml ...
>> INFO: Reading file 
>> c:/Inetpub/wwwroot/ISB/data/allDIAv3/interact-160611_0001_fulldia_1_q1.pep.xml
>>  ...
>> to be setModByType: 112WARNING: Cannot initialize for sequence: 
>> Q[112]IN[115]QDAM[147]SMQQSSALR, unknown mods may exist in spectrum 
>> 160611_0001_fullDIA_1_Q1.01159.01159.2
>>
>> *Command FAILED*
>> RETURN CODE:65280
>>
>> I think it might be related to having deamidation enabled with variable
>> n-terminal pyroglutamate formation.
>>
>> Best,
>> Jesse
>>
>> On Wednesday, July 20, 2016 at 1:45:10 PM UTC-7, David Shteynberg wrote:
>>
>> Hello Jesse,
>>
>> There have been many bug fixes and improvements made to PTMProphet since
>> the last release.  You can test out the new binary by replacing your
>> PTMProphetParser.exe file in C:\Inetpu\tpp-bin with this pre-release
>> version made for TPP 5:
>> https://dl.dropboxusercontent.com/u/21286225/PTMProphetParser.exe
>>
>>
>> I ran it on your file without the WARNING messages as follows:
>>
>> PTMProphetParser.exe K:42.010565,M:15.994915,NQ:0.984016 MZTOL=0.055
>> interact-160611_0001_fulldia_1_q1_msgf.pep.xml 
>> msgf.test1.interact.ptm.pep.xml
>>
>>
>> Let us know should other issues arise.
>>
>> Thank you,
>> -David
>>
>>
>>
>>
>>
>> On Wed, Jul 20, 2016 at 12:22 PM, Jesse <[email protected]> wrote:
>>
>> Hello David,
>>
>> I'm having a related issue.  I'm searching with Comet, X!tandem, and
>> MSGF+, and results from MSGF+ or tandem that have been filtered with
>> peptide prophet using xinteract.  When I run the following on files from
>> MSGF+ searches or X!tandem searches:
>>
>> *EXECUTING: cd c:/Inetpub/wwwroot/ISB/data/allDIAv3&
>> c:\Inetpub\tpp-bin\PTMProphetParser K,42.010565,M,15.994915,NQ,0.984016
>> MZTOL=0.055
>> c:/Inetpub/wwwroot/ISB/data/allDIAv3/interact-160611_0001_fulldia_1_q1_msgf.pep.xml
>> msgf.test1.interact.ptm.pep.xml *
>>
>> I get many errors in the form of (also see attached text logs):
>>
>> WARNING: Illegal peptide found in pepXML with non-matching mass: 
>> QRHKQ[129]N[115]LYGDYAFDAN[115]R
>>      Neutral Mass (from pepXML) = 2080.92
>>      Neutral Computed Mass for Evaluation = 2097.95
>>      PPM difference = 8182.22WARNING: Illegal peptide found in pepXML with 
>> non-matching mass: M[147]TISFLLR
>>      Neutral Mass (from pepXML) = 1037.56
>>      Neutral Computed Mass for Evaluation = 995.547
>>      PPM difference = 40489.9
>>
>> However, these PTM prophet runs finish with error code = 0 and produce 
>> pep.xml files that I can view and that have localization scores.  Is this OK?
>>
>> More importantly, when I run the same command on the comet output, I get 
>> nothing:
>>
>> *EXECUTING: cd
>> c:/Inetpub/wwwroot/ISB/data/allDIAv3&
>> c:\Inetpub\tpp-bin\PTMProphetParser K,42.010565,M,15.994915,NQ,0.984016
>> MZTOL=0.055
>> c:/Inetpub/wwwroot/ISB/data/allDIAv3/interact-160611_0001_fulldia_1_q1_c.pep.xml
>>  comet.test1.interact.ptm.pep.xml
>> *
>>
>> INFO: Writing file comet.test1.interact.ptm.pep.xml ...
>> INFO: Reading file 
>> c:/Inetpub/wwwroot/ISB/data/allDIAv3/interact-160611_0001_fulldia_1_q1_c.pep.xml
>>  ...
>> *Command FAILED*
>>
>> RETURN CODE:65280
>> I could omit the comet search results if you say that the PTMprophet results 
>> for MSGF+ and X!tandem searches are OK despite the errors.
>>
>> Here is a link to all the relevant files on google drive:
>>
>> https://drive.google.com/folderview?id=0B4N83JlasjgsVVBBVDM0NGlCcTQ&usp=sharing
>>
>> Your help is appreciated.
>>
>> Best regards,
>> Jesse Meyer
>>
>> On Thursday, May 14, 2015 at 1:47:03 PM UTC-7, David Shteynberg wrote:
>>
>> Hello Delphine,
>>
>> I have discovered the bug in Mascot2XML that was getting the masses wrong
>> in the pepXML.  You will need to reconvert from the dat file and rerun the
>> PeptideProphet Mascot analysis followed by iProphet analysis followed by
>> PTMProphet.
>>
>> The corrected Mascol2XML binary for windows can be downloaded here for
>> now:
>>
>> https://dl.dropboxusercontent.com/u/21286225/Mascot2XML.exe
>>
>> The updated version of PTMProphetParser for windows can be found here for
>> now:
>>
>> https://dl.dropboxusercontent.com/u/21286225/PTMProphetParser.exe
>>
>>
>> Backup and replace the copies you have in C:\Inetpub\tpp-bin with these
>> copies if you want to test it out.
>>
>> Thanks,
>> -David
>>
>>
>> On Fri, May 1, 2015 at 11:27 AM, David Shteynberg <
>> [email protected]> wrote:
>>
>> Hello Delphine,
>>
>> I ran the new version, which gives more information.  The problem here is
>> that MASCOT generated and reported massed in the pepXML file are not close
>> enough to the PTMProphet computed masses.  The error is small <0.01 for K
>> methylation and is likely related to the masses used internally in MASCOT
>> being different from those used internally by the other search engines you
>> applied.
>>
>> If you can send me the dat file I can dig deeper into the MASCOT issue.
>>
>> Thanks,
>> -David
>>
>> Here are the new  warnings:
>>
>> *EXECUTING: cd c:/Inetpub/wwwroot/ISB/data/Delphine&&
>> c:\Inetpub\tpp-bin\PTMProphetParser
>> CQ,-17.0265,M,15.995,K,14.0156,E,-18.0106,n,42.0106 MZTOL=0.2
>> c:/Inetpub/wwwroot/ISB/data/Delphine/327_05_01_020_150417_01_MTCS_0_D_interact.iproph.pep.xml
>> interact.ptm.pep.xml *
>>
>> INFO: Writing file interact.ptm.pep.xml ...
>> INFO: Reading file 
>> c:/Inetpub/wwwroot/ISB/data/Delphine/327_05_01_020_150417_01_MTCS_0_D_interact.iproph.pep.xml
>>  ...WARNING: Illegal peptide found in pepXML with non-matching mass: 
>> GTAGK[142]VIK[142]
>>      Neutral Mass (from pepXML) = 800.52
>>      Neutral Computed Mass for Evaluation = 800.512WARNING: Illegal peptide 
>> found in pepXML with non-matching mass: ILVAIM[147]K[142]
>>      Neutral Mass (from pepXML) = 816.522
>>      Neutral Computed Mass for Evaluation = 816.514WARNING: Illegal peptide 
>> found in pepXML with non-matching mass: VTNLHVK[142]
>>      Neutral Mass (from pepXML) = 823.499
>>      Neutral Computed Mass for Evaluation = 823.492WARNING: Illegal peptide 
>> found in pepXML with non-matching mass: ALK[142]EPPR
>>      Neutral Mass (from pepXML) = 823.499
>>      Neutral Computed Mass for Evaluation = 823.492WARNING: Illegal peptide 
>> found in pepXML with non-matching mass: ALK[142]EPPR
>>      Neutral Mass (from pepXML) = 823.499
>>      Neutral Computed Mass for Evaluation = 823.492WARNING: Illegal peptide 
>> found in pepXML with non-matching mass: ALK[142]EPPR
>>      Neutral Mass (from pepXML) = 823.499
>>      Neutral Computed Mass for Evaluation = 823.492WARNING: Illegal peptide 
>> found in pepXML with non-matching mass: K[142]EGVK[142]PR
>>      Neutral Mass (from pepXML) = 840.526
>>      Neutral Computed Mass for Evaluation = 840.518WARNING: Illegal peptide 
>> found in pepXML with non-matching mass: VLEPENK[142]
>>      Neutral Mass (from pepXML) = 841.462
>>      Neutral Computed Mass for Evaluation = 841.455WARNING: Illegal peptide 
>> found in pepXML with non-matching mass: VLNILEK[142]
>>      Neutral Mass (from pepXML) = 841.535
>>      Neutral Computed Mass for Evaluation = 841.527WARNING: Illegal peptide 
>> found in pepXML with non-matching mass: WLVVPDK[142]
>>      Neutral Mass (from pepXML) = 869.509
>>      Neutral Computed Mass for Evaluation = 869.501WARNING: Illegal peptide 
>> found in pepXML with non-matching mass: LLLTTPAK[142]
>>      Neutral Mass (from pepXML) = 869.566
>>      Neutral Computed Mass for Evaluation = 869.559WARNING: Illegal peptide 
>> found in pepXML with non-matching mass: K[142]PHPPKR
>>      Neutral Mass (from pepXML) = 872.542
>>      Neutral Computed Mass for Evaluation = 872.534WARNING: Illegal peptide 
>> found in pepXML with non-matching mass: KPHPPK[142]R
>>      Neutral Mass (from pepXML) = 872.542
>>      Neutral Computed Mass for Evaluation = 872.534WARNING: Illegal peptide 
>> found in pepXML with non-matching mass: DADFNGTK[142]
>>      Neutral Mass (from pepXML) = 880.4
>>      Neutral Computed Mass for Evaluation = 880.393WARNING: Illegal peptide 
>> found in pepXML with non-matching mass: LYSC[160]TPR
>>      Neutral Mass (from pepXML) = 895.43
>>      Neutral Computed Mass for Evaluation = 895.422WARNING: Illegal peptide 
>> found in pepXML with non-matching mass: KAVVVC[160]PK
>>      Neutral Mass (from pepXML) = 899.534
>>      Neutral Computed Mass for Evaluation = 899.526WARNING: Illegal peptide 
>> found in pepXML with non-matching mass: KTPM[147]C[160]EK
>>      Neutral Mass (from pepXML) = 908.417
>>      Neutral Computed Mass for Evaluation = 908.41WARNING: Illegal peptide 
>> found in pepXML with non-matching mass: LAALAEALK[142]
>>      Neutral Mass (from pepXML) = 912.572
>>      Neutral Computed Mass for Evaluation = 912.564WARNING: Illegal peptide 
>> found in pepXML with non-matching mass: VK[142]THLFR
>>      Neutral Mass (from pepXML) = 913.558
>>      Neutral Computed Mass for Evaluation = 913.55WARNING: Illegal peptide 
>> found in pepXML with non-matching mass: M[147]EFLKQK
>>      Neutral Mass (from pepXML) = 938.497
>>      Neutral Computed Mass for Evaluation = 938.49WARNING: Illegal peptide 
>> found in pepXML with non-matching mass: M[147]DK[142]TFER
>>      Neutral Mass (from pepXML) = 955.451
>>      Neutral Computed Mass for Evaluation = 955.443WARNING: Illegal peptide 
>> found in pepXML with non-matching mass: GAGM[147]SFSRK
>>      Neutral Mass (from pepXML) = 955.462
>>      Neutral Computed Mass for Evaluation = 955.455WARNING: Illegal peptide 
>> found in pepXML with non-matching mass: ALLVYC[160]VK
>>      Neutral Mass (from pepXML) = 964.549
>>      Neutral Computed Mass for Evaluation = 964.542WARNING: Illegal peptide 
>> found in pepXML with non-matching mass: ALLVYC[160]VK
>>      Neutral Mass (from pepXML) = 964.549
>>      Neutral Computed Mass for Evaluation = 964.542WARNING: Illegal peptide 
>> found in pepXML with non-matching mass: VFISC[160]K[142]VQ
>>      Neutral Mass (from pepXML) = 993.54
>>      Neutral Computed Mass for Evaluation = 993.532WARNING: Illegal peptide 
>> found in pepXML with non-matching mass: VM[147]LYPSRI
>>      Neutral Mass (from pepXML) = 993.539
>>      Neutral Computed Mass for Evaluation = 993.532WARNING: Illegal peptide 
>> found in pepXML with non-matching mass: M[147]C[160]GDC[160]VEK
>>      Neutral Mass (from pepXML) = 1013.37
>>      Neutral Computed Mass for Evaluation = 1013.36WARNING: Illegal peptide 
>> found in pepXML with non-matching mass: LSLHLSPIK[142]
>>      Neutral Mass (from pepXML) = 1020.64
>>      Neutral Computed Mass for Evaluation = 1020.63WARNING: Illegal peptide 
>> found in pepXML with non-matching mass: M[147]SVNISTAGK
>>      Neutral Mass (from pepXML) = 1022.51
>>      Neutral Computed Mass for Evaluation = 1022.51WARNING: Illegal peptide 
>> found in pepXML with non-matching mass: NLMANRPAK[142]
>>      Neutral Mass (from pepXML) = 1027.57
>>      Neutral Computed Mass for Evaluation = 1027.56WARNING: Illegal peptide 
>> found in pepXML with non-matching mass: TAM[147]LLALQR
>>      Neutral Mass (from pepXML) = 1031.59
>>      Neutral Computed Mass for Evaluation = 1031.58WARNING: Illegal peptide 
>> found in pepXML with non-matching mass: LSSC[160]KPPKK
>>      Neutral Mass (from pepXML) = 1043.59
>>      Neutral Computed Mass for Evaluation = 1043.58WARNING: Illegal peptide 
>> found in pepXML with non-matching mass: K[142]QLYPFFK
>>      Neutral Mass (from pepXML) = 1083.62
>>      Neutral Computed Mass for Evaluation = 1083.61WARNING: Illegal peptide 
>> found in pepXML with non-matching mass: KQLYPFFK[142]
>>      Neutral Mass (from pepXML) = 1083.62
>>      Neutral Computed Mass for Evaluation = 1083.61WARNING: Illegal peptide 
>> found in pepXML with non-matching mass: TK[142]LNYNPPK
>>      Neutral Mass (from pepXML) = 1087.61
>>      Neutral Computed Mass for Evaluation = 1087.6WARNING: Illegal peptide 
>> found in pepXML with non-matching mass: TKLNYNPPK[142]
>>      Neutral Mass (from pepXML) = 1087.61
>>      Neutral Computed Mass for Evaluation = 1087.6WARNING: Illegal peptide 
>> found in pepXML with non-matching mass: IIK[142]ALDLPAK
>>      Neutral Mass (from pepXML) = 1094.71
>>      Neutral Computed Mass for Evaluation = 1094.71WARNING: Illegal peptide 
>> found in pepXML with non-matching mass: IIKALDLPAK[142]
>>      Neutral Mass (from pepXML) = 1094.71
>>      Neutral Computed Mass for Evaluation = 1094.71WARNING: Illegal peptide 
>> found in pepXML with non-matching mass: VK[142]PNVAVLSR
>>      Neutral Mass (from pepXML) = 1095.68
>>      Neutral Computed Mass for Evaluation = 1095.68WARNING: Illegal peptide 
>> found in pepXML with non-matching mass: ASSLPSSAPAVK[142]
>>      Neutral Mass (from pepXML) = 1127.63
>>      Neutral Computed Mass for Evaluation = 1127.62WARNING: Illegal peptide 
>> found in pepXML with non-matching mass: SLASSAQPGLGK[142]
>>      Neutral Mass (from pepXML) = 1128.62
>>      Neutral Computed Mass for Evaluation = 1128.61WARNING: Illegal peptide 
>> found in pepXML with non-matching mass: AEM[147]EELM[147]EK
>>      Neutral Mass (from pepXML) = 1140.48
>>      Neutral Computed Mass for Evaluation = 1140.47WARNING: Illegal peptide 
>> found in pepXML with non-matching mass: NDC[160]TTQSNVK
>>      Neutral Mass (from pepXML) = 1165.51
>>      Neutral Computed Mass for Evaluation = 1165.5WARNING: Illegal peptide 
>> found in pepXML with non-matching mass: LNK[142]TPIPQTK[142]
>>      Neutral Mass (from pepXML) = 1166.71
>>      Neutral Computed Mass for Evaluation = 1166.7WARNING: Illegal peptide 
>> found in pepXML with non-matching mass: SSLLGTGITSPK[142]
>>      Neutral Mass (from pepXML) = 1173.67
>>      Neutral Computed Mass for Evaluation = 1173.66WARNING: Illegal peptide 
>> found in pepXML with non-matching mass: LIDLC[160]QPTQK[142]
>>      Neutral Mass (from pepXML) = 1228.66
>>      Neutral Computed Mass for Evaluation = 1228.65WARNING: Illegal peptide 
>> found in pepXML with non-matching mass: RNQDRPSLLK[142]
>>      Neutral Mass (from pepXML) = 1239.71
>>      Neutral Computed Mass for Evaluation = 1239.7WARNING: Illegal peptide 
>> found in pepXML with non-matching mass: K[142]RPDEMLLPK
>>      Neutral Mass (from pepXML) = 1239.71
>>      Neutral Computed Mass for Evaluation = 1239.7WARNING: Illegal peptide 
>> found in pepXML with non-matching mass: KRPDEMLLPK[142]
>>      Neutral Mass (from pepXML) = 1239.71
>>      Neutral Computed Mass for Evaluation = 1239.7WARNING: Illegal peptide 
>> found in pepXML with non-matching mass: LAERPNIKM[147]R
>>      Neutral Mass (from pepXML) = 1242.69
>>      Neutral Computed Mass for Evaluation = 1242.69WARNING: Illegal peptide 
>> found in pepXML with non-matching mass: K[142]ITGEIMHALK
>>      Neutral Mass (from pepXML) = 1253.72
>>      Neutral Computed Mass for Evaluation = 1253.72WARNING: Illegal peptide 
>> found in pepXML with non-matching mass: KITGEIMHALK[142]
>>      Neutral Mass (from pepXML) = 1253.72
>>      Neutral Computed Mass for Evaluation = 1253.72WARNING: Illegal peptide 
>> found in pepXML with non-matching mass: NVQTPQC[160]K[142]LR
>>      Neutral Mass (from pepXML) = 1256.67
>>      Neutral Computed Mass for Evaluation = 1256.67WARNING: Illegal peptide 
>> found in pepXML with non-matching mass: VGAWGISGEPRK[142]
>>      Neutral Mass (from pepXML) = 1269.69
>>      Neutral Computed Mass for Evaluation = 1269.68WARNING: Illegal peptide 
>> found in pepXML with non-matching mass: DLLHPSPEEEK[142]
>>      Neutral Mass (from pepXML) = 1306.65
>>      Neutral Computed Mass for Evaluation = 1306.64WARNING: Illegal peptide 
>> found in pepXML with non-matching mass: GALGPGGPLGHPGEK[142]
>>      Neutral Mass (from pepXML) = 1356.72
>>      Neutral Computed Mass for Evaluation = 1356.71WARNING: Illegal peptide 
>> found in pepXML with non-matching mass: KAGTVM[147]FEYGMR
>>      Neutral Mass (from pepXML) = 1404.66
>>      Neutral Computed Mass for Evaluation = 1404.65WARNING: Illegal peptide 
>> found in pepXML with non-matching mass: KAGTVMFEYGM[147]R
>>      Neutral Mass (from pepXML) = 1404.66
>>      Neutral Computed Mass for Evaluation = 1404.65WARNING: Illegal peptide 
>> found in pepXML with non-matching mass: REENQNEVNM[147]K
>>      Neutral Mass (from pepXML) = 1405.63
>>      Neutral Computed Mass for Evaluation = 1405.63WARNING: Illegal peptide 
>> found in pepXML with non-matching mass: K[142]NSGC[160]TEVC[160]HTR
>>      Neutral Mass (from pepXML) = 1461.65
>>      Neutral Computed Mass for Evaluation = 1461.65WARNING: Illegal peptide 
>> found in pepXML with non-matching mass: QILLLLPVM[147]INM[147]LK[142]
>>      Neutral Mass (from pepXML) = 1684.01
>>      Neutral Computed Mass for Evaluation = 1684WARNING: Illegal peptide 
>> found in pepXML with non-matching mass: QILLLLPVM[147]INM[147]LK[142]
>>      Neutral Mass (from pepXML) = 1684.01
>>      Neutral Computed Mass for Evaluation = 1684WARNING: Illegal peptide 
>> found in pepXML with non-matching mass: LQGEGLSVAGIVC[160]HVGK
>>      Neutral Mass (from pepXML) = 1722.92
>>      Neutral Computed Mass for Evaluation = 1722.91WARNING: Illegal peptide 
>> found in pepXML with non-matching mass: SWAEAYK[142]DLENSDEFK[142]
>>      Neutral Mass (from pepXML) = 1958.9
>>      Neutral Computed Mass for Evaluation = 1958.89WARNING: Illegal peptide 
>> found in pepXML with non-matching mass: DLVSGGSNEGNGK[142]EDWAMK[142]
>>      Neutral Mass (from pepXML) = 2020.92
>>      Neutral Computed Mass for Evaluation = 2020.92WARNING: Illegal peptide 
>> found in pepXML with non-matching mass: AVATGKM[147]DENQFVAVTSTNAAK
>>      Neutral Mass (from pepXML) = 2268.11
>>      Neutral Computed Mass for Evaluation = 2268.11WARNING: Illegal peptide 
>> found in pepXML with non-matching mass: LPMASSMEHGK[142]DLPSVQLLMK[142]
>>      Neutral Mass (from pepXML) = 2339.21
>>      Neutral Computed Mass for Evaluation = 2339.21WARNING: Illegal peptide 
>> found in pepXML with non-matching mass: M[147]QILTPPLQSSVELVADPETR
>>      Neutral Mass (from pepXML) = 2339.21
>>      Neutral Computed Mass for Evaluation = 2339.2WARNING: Illegal peptide 
>> found in pepXML with non-matching mass: LTPTEIVLILPM[147]PEQRNSLTAK[142]
>>      Neutral Mass (from pepXML) = 2493.4
>>      Neutral Computed Mass for Evaluation = 2493.39WARNING: Illegal peptide 
>> found in pepXML with non-matching mass: QKLC[160]YVSQGNASFTYGYEYLGC[160]TSR
>>      Neutral Mass (from pepXML) = 2951.33
>>      Neutral Computed Mass for Evaluation = 2951.32WARNING: Illegal peptide 
>> found in pepXML with non-matching mass: DNEIQMDMTLGPIEEAYAILNRFEVEVTK[142]
>>      Neutral Mass (from pepXML) = 3381.66
>>      Neutral Computed Mass for Evaluation = 3381.65WARNING: Illegal peptide 
>> found in pepXML with non-matching mass: 
>> QM[147]GQEIGNELDEQNEIIDDLANLVENTDEK[142]
>>      Neutral Mass (from pepXML) = 3445.58
>>      Neutral Computed Mass for Evaluation = 3445.57WARNING: Illegal peptide 
>> found in pepXML with non-matching mass: 
>> HLVC[160]SFRLYPFTVHTVSPGNSHLALYQVFK[142]
>>      Neutral Mass (from pepXML) = 3530.84
>>      Neutral Computed Mass for Evaluation = 3530.83WARNING: Illegal peptide 
>> found in pepXML with non-matching mass: 
>> EVK[142]VYLLTTSSAPYC[160]NAFQLLTVAPNHGISLK[142]
>>      Neutral Mass (from pepXML) = 3561.9
>>      Neutral Computed Mass for Evaluation = 3561.89WARNING: Illegal peptide 
>> found in pepXML with non-matching mass: 
>> K[142]GNFQLQGTM[147]LSDGQGFTQDDVQAAEVTYGAMAR
>>      Neutral Mass (from pepXML) = 3663.7
>>      Neutral Computed Mass for Evaluation = 3663.69WARNING: Illegal peptide 
>> found in pepXML with non-matching mass: 
>> K[142]GNFQLQGTMLSDGQGFTQDDVQAAEVTYGAM[147]AR
>>      Neutral Mass (from pepXML) = 3663.7
>>      Neutral Computed Mass for Evaluation = 3663.69WARNING: Illegal peptide 
>> found in pepXML with non-matching mass: 
>> EESLHSILAGSDM[147]TVSQILLTQHGIPVM[147]NLSDGK[142]
>>      Neutral Mass (from pepXML) = 3665.84
>>      Neutral Computed Mass for Evaluation = 3665.83WARNING: Illegal peptide 
>> found in pepXML with non-matching mass: 
>> DPPAQC[160]SAGPVGDDM[147]FHWQATIM[147]GPISNYMLDN
>>      Neutral Mass (from pepXML) = 3666.56
>>      Neutral Computed Mass for Evaluation = 3666.55WARNING: Illegal peptide 
>> found in pepXML with non-matching mass: 
>> DPPAQC[160]SAGPVGDDM[147]FHWQATIMGPISNYM[147]LDN
>>      Neutral Mass (from pepXML) = 3666.56
>>      Neutral Computed Mass for Evaluation = 3666.55WARNING: Illegal peptide 
>> found in pepXML with non-matching mass: 
>> DPPAQC[160]SAGPVGDDMFHWQATIM[147]GPISNYM[147]LDN
>>      Neutral Mass (from pepXML) = 3666.56
>>      Neutral Computed Mass for Evaluation = 3666.55WARNING: Illegal peptide 
>> found in pepXML with non-matching mass: 
>> LYC[160]NGDGEWM[147]VPIGRC[160]TC[160]K[142]PGYEPENSVAC[160]K
>>      Neutral Mass (from pepXML) = 3676.6
>>      Neutral Computed Mass for Evaluation = 3676.59WARNING: Illegal peptide 
>> found in pepXML with non-matching mass: 
>> LYC[160]NGDGEWM[147]VPIGRC[160]TC[160]KPGYEPENSVAC[160]K[142]
>>      Neutral Mass (from pepXML) = 3676.6
>>      Neutral Computed Mass for Evaluation = 3676.59WARNING: Illegal peptide 
>> found in pepXML with non-matching mass: 
>> ASVDSGNEDIIEALISLFYGVM[147]TPMLNPLIYSLR
>>      Neutral Mass (from pepXML) = 3756.91
>>      Neutral Computed Mass for Evaluation = 3756.9WARNING: Illegal peptide 
>> found in pepXML with non-matching mass: 
>> ASVDSGNEDIIEALISLFYGVMTPM[147]LNPLIYSLR
>>      Neutral Mass (from pepXML) = 3756.91
>>      Neutral Computed Mass for Evaluation = 3756.9WARNING: Illegal peptide 
>> found in pepXML with non-matching mass: 
>> M[147]GFNRPSKIQENALPLMLAEPPQNLIAQSQSGTGK
>>      Neutral Mass (from pepXML) = 3780.94
>>      Neutral Computed Mass for Evaluation = 3780.93WARNING: Illegal peptide 
>> found in pepXML with non-matching mass: 
>> MGFNRPSKIQENALPLM[147]LAEPPQNLIAQSQSGTGK
>>      Neutral Mass (from pepXML) = 3780.94
>>      Neutral Computed Mass for Evaluation = 3780.93WARNING: Illegal peptide 
>> found in pepXML with non-matching mass: 
>> GFPSQC[160]YSAQTLPELC[160]SPQDELDFLM[147]EALIISK
>>      Neutral Mass (from pepXML) = 3802.79
>>      Neutral Computed Mass for Evaluation = 3802.78WARNING: Illegal peptide 
>> found in pepXML with non-matching mass: 
>> LYTM[147]DGITVTVADLFFAGTETTSTTLRYGLLILMK[142]
>>      Neutral Mass (from pepXML) = 3885.03
>>      Neutral Computed Mass for Evaluation = 3885.02WARNING: Illegal peptide 
>> found in pepXML with non-matching mass: 
>> LYTMDGITVTVADLFFAGTETTSTTLRYGLLILM[147]K[142]
>>      Neutral Mass (from pepXML) = 3885.03
>>      Neutral Computed Mass for Evaluation = 3885.02WARNING: Illegal peptide 
>> found in pepXML with non-matching mass: 
>> FVHKSFVEVNEEGTEAAAASSC[160]FVVAEC[160]C[160]M[147]ESGPR
>>      Neutral Mass (from pepXML) = 3906.7
>>      Neutral Computed Mass for Evaluation = 3906.7WARNING: Illegal peptide 
>> found in pepXML with non-matching mass: 
>> GPLLAQEM[147]PTVSVLEYALPQRPPQGPEDDRDLSER
>>      Neutral Mass (from pepXML) = 3918.95
>>      Neutral Computed Mass for Evaluation = 3918.94
>>
>> *Command Successful*
>> RETURN CODE:0
>>
>>
>>
>>
>> On Thu, Apr 30, 2015 at 2:18 AM, delphine wood <[email protected]> wrote:
>>
>> Hi,
>>
>> I send you the mzxml file through wetransfer.
>> I tried with this command
>> * /opt/tpp/bin/PTMProphetParser STY,79.966,K,14.0156,M,15.995 MZTOL=0.2
>> /opt/tpp/data/327_05_01/327_05_01_020_150417_01_MTCS_0_D_interact.iproph.pep.xml
>> interact.ptm.pep.xml *
>>
>> I got these warnings:
>>
>> INFO: Writing file interact.ptm.pep.xml ...
>> INFO: Reading file 
>> /opt/tpp/data/327_05_01/327_05_01_020_150417_01_MTCS_0_D_interact.iproph.pep.xml
>>  ...WARNING: Illegal peptide with unknown mod: GTAGK[142]VIK[142]WARNING: 
>> Illegal peptide with unknown mod: ILVAIM[147]K[142]WARNING: Illegal peptide 
>> with unknown mod: VTNLHVK[142]WARNING: Illegal peptide with unknown mod: 
>> ALK[142]EPPRWARNING: Illegal peptide with unknown mod: ALK[142]EPPRWARNING: 
>> Illegal peptide with unknown mod: ALK[142]EPPRWARNING: Illegal peptide with 
>> unknown mod: K[142]EGVK[142]PRWARNING: Illegal peptide with unknown mod: 
>> VLEPENK[142]WARNING: Illegal peptide with unknown mod: VLNILEK[142]WARNING: 
>> Illegal peptide with unknown mod: WLVVPDK[142]WARNING: Illegal peptide with 
>> unknown mod: LLLTTPAK[142]WARNING: Illegal peptide with unknown mod: 
>> K[142]PHPPKRWARNING: Illegal peptide with unknown mod: KPHPPK[142]RWARNING: 
>> Illegal peptide with unknown mod: DADFNGTK[142]WARNING: Illegal peptide with 
>> unknown mod: LYSC[160]TPRWARNING: Illegal peptide with unknown mod: 
>> KAVVVC[160]PKWARNING: Illegal peptide with unknown mod: 
>> KTPM[147]C[160]EKWARNING: Illegal peptide with unknown mod: 
>> LAALAEALK[142]WARNING: Illegal peptide with unknown mod: 
>> VK[142]THLFRWARNING: Illegal peptide with unknown mod: M[147]EFLKQKWARNING: 
>> Illegal peptide with unknown mod: M[147]DK[142]TFERWARNING: Illegal peptide 
>> with unknown mod: GAGM[147]SFSRKWARNING: Illegal peptide with unknown mod: 
>> ALLVYC[160]VKWARNING: Illegal peptide with unknown mod: 
>> ALLVYC[160]VKWARNING: Illegal peptide with unknown mod: 
>> VFISC[160]K[142]VQWARNING: Illegal peptide with unknown mod: 
>> VM[147]LYPSRIWARNING: Illegal peptide with unknown mod: 
>> M[147]C[160]GDC[160]VEKWARNING: Illegal peptide with unknown mod: 
>> LSLHLSPIK[142]WARNING: Illegal peptide with unknown mod: 
>> M[147]SVNISTAGKWARNING: Illegal peptide with unknown mod: 
>> NLMANRPAK[142]WARNING: Illegal peptide with unknown mod: 
>> TAM[147]LLALQRWARNING: Illegal peptide with unknown mod: 
>> LSSC[160]KPPKKWARNING: Illegal peptide with unknown mod: 
>> K[142]QLYPFFKWARNING: Illegal peptide with unknown mod: 
>> KQLYPFFK[142]WARNING: Illegal peptide with unknown mod: 
>> TK[142]LNYNPPKWARNING: Illegal peptide with unknown mod: 
>> TKLNYNPPK[142]WARNING: Illegal peptide with unknown mod: 
>> IIK[142]ALDLPAKWARNING: Illegal peptide with unknown mod: 
>> IIKALDLPAK[142]WARNING: Illegal peptide with unknown mod: 
>> VK[142]PNVAVLSRWARNING: Illegal peptide with unknown mod: 
>> ASSLPSSAPAVK[142]WARNING: Illegal peptide with unknown mod: 
>> SLASSAQPGLGK[142]WARNING: Illegal peptide with unknown mod: 
>> AEM[147]EELM[147]EKWARNING: Illegal peptide with unknown mod: 
>> NDC[160]TTQSNVKWARNING: Illegal peptide with unknown mod: 
>> LNK[142]TPIPQTK[142]WARNING: Illegal peptide with unknown mod: 
>> SSLLGTGITSPK[142]WARNING: Illegal peptide with unknown mod: 
>> LIDLC[160]QPTQK[142]WARNING: Illegal peptide with unknown mod: 
>> RNQDRPSLLK[142]WARNING: Illegal peptide with unknown mod: 
>> K[142]RPDEMLLPKWARNING: Illegal peptide with unknown mod: 
>> KRPDEMLLPK[142]WARNING: Illegal peptide with unknown mod: 
>> LAERPNIKM[147]RWARNING: Illegal peptide with unknown mod: 
>> K[142]ITGEIMHALKWARNING: Illegal peptide with unknown mod: 
>> KITGEIMHALK[142]WARNING: Illegal peptide with unknown mod: 
>> NVQTPQC[160]K[142]LRWARNING: Illegal peptide with unknown mod: 
>> VGAWGISGEPRK[142]WARNING: Illegal peptide with unknown mod: 
>> DLLHPSPEEEK[142]WARNING: Illegal peptide with unknown mod: 
>> GALGPGGPLGHPGEK[142]WARNING: Illegal peptide with unknown mod: 
>> KAGTVM[147]FEYGMRWARNING: Illegal peptide with unknown mod: 
>> KAGTVMFEYGM[147]RWARNING: Illegal peptide with unknown mod: 
>> REENQNEVNM[147]KWARNING: Illegal peptide with unknown mod: 
>> K[142]NSGC[160]TEVC[160]HTRWARNING: Illegal peptide with unknown mod: 
>> QILLLLPVM[147]INM[147]LK[142]WARNING: Illegal peptide with unknown mod: 
>> QILLLLPVM[147]INM[147]LK[142]WARNING: Illegal peptide with unknown mod: 
>> LQGEGLSVAGIVC[160]HVGKWARNING: Illegal peptide with unknown mod: 
>> SWAEAYK[142]DLENSDEFK[142]WARNING: Illegal peptide with unknown mod: 
>> DLVSGGSNEGNGK[142]EDWAMK[142]WARNING: Illegal peptide with unknown mod: 
>> AVATGKM[147]DENQFVAVTSTNAAKWARNING: Illegal peptide with unknown mod: 
>> LPMASSMEHGK[142]DLPSVQLLMK[142]WARNING: Illegal peptide with unknown mod: 
>> M[147]QILTPPLQSSVELVADPETRWARNING: Illegal peptide with unknown mod: 
>> LTPTEIVLILPM[147]PEQRNSLTAK[142]WARNING: Illegal peptide with unknown mod: 
>> QKLC[160]YVSQGNASFTYGYEYLGC[160]TSRWARNING: Illegal peptide with unknown 
>> mod: DNEIQMDMTLGPIEEAYAILNRFEVEVTK[142]WARNING: Illegal peptide with unknown 
>> mod: QM[147]GQEIGNELDEQNEIIDDLANLVENTDEK[142]WARNING: Illegal peptide with 
>> unknown mod: HLVC[160]SFRLYPFTVHTVSPGNSHLALYQVFK[142]WARNING: Illegal 
>> peptide with unknown mod: 
>> EVK[142]VYLLTTSSAPYC[160]NAFQLLTVAPNHGISLK[142]WARNING: Illegal peptide with 
>> unknown mod: K[142]GNFQLQGTM[147]LSDGQGFTQDDVQAAEVTYGAMARWARNING: Illegal 
>> peptide with unknown mod: 
>> K[142]GNFQLQGTMLSDGQGFTQDDVQAAEVTYGAM[147]ARWARNING: Illegal peptide with 
>> unknown mod: EESLHSILAGSDM[147]TVSQILLTQHGIPVM[147]NLSDGK[142]WARNING: 
>> Illegal peptide with unknown mod: 
>> DPPAQC[160]SAGPVGDDM[147]FHWQATIM[147]GPISNYMLDNWARNING: Illegal peptide 
>> with unknown mod: DPPAQC[160]SAGPVGDDM[147]FHWQATIMGPISNYM[147]LDNWARNING: 
>> Illegal peptide with unknown mod: 
>> DPPAQC[160]SAGPVGDDMFHWQATIM[147]GPISNYM[147]LDNWARNING: Illegal peptide 
>> with unknown mod: 
>> LYC[160]NGDGEWM[147]VPIGRC[160]TC[160]K[142]PGYEPENSVAC[160]KWARNING: 
>> Illegal peptide with unknown mod: 
>> LYC[160]NGDGEWM[147]VPIGRC[160]TC[160]KPGYEPENSVAC[160]K[142]WARNING: 
>> Illegal peptide with unknown mod: 
>> ASVDSGNEDIIEALISLFYGVM[147]TPMLNPLIYSLRWARNING: Illegal peptide with unknown 
>> mod: ASVDSGNEDIIEALISLFYGVMTPM[147]LNPLIYSLRWARNING: Illegal peptide with 
>> unknown mod: M[147]GFNRPSKIQENALPLMLAEPPQNLIAQSQSGTGKWARNING: Illegal 
>> peptide with unknown mod: MGFNRPSKIQENALPLM[147]LAEPPQNLIAQSQSGTGKWARNING: 
>> Illegal peptide with unknown mod: 
>> GFPSQC[160]YSAQTLPELC[160]SPQDELDFLM[147]EALIISKWARNING: Illegal peptide 
>> with unknown mod: LYTM[147]DGITVTVADLFFAGTETTSTTLRYGLLILMK[142]WARNING: 
>> Illegal peptide with unknown mod: 
>> LYTMDGITVTVADLFFAGTETTSTTLRYGLLILM[147]K[142]WARNING: Illegal peptide with 
>> unknown mod: FVHKSFVEVNEEGTEAAAASSC[160]FVVAEC[160]C[160]M[147]ESGPRWARNING: 
>> Illegal peptide with unknown mod: GPLLAQEM[147]PTVSVLEYALPQRPPQGPEDDRDLSER
>> Failed to open input file 
>> '/opt/tpp/data/327_05_01/spectrast/327_05_01_020_150417_01.mzXML'.ERROR: 
>> cannot read scan in data file 
>> /opt/tpp/data/327_05_01/spectrast/327_05_01_020_150417_01.mzXML exiting ...
>>
>>
>> There is an error at the end. I don't understand why it is looking for
>> the mzxml file in the spectrast folder... Thus I copied the mzxml file to
>> the spectrast folder and it seems to work.
>> Could you please check if the latest PTMprophet version gives the same
>> warnings?
>>
>> Thanks for your help :-)
>>
>> Delphine
>>
>> 2015-04-29 19:30 GMT+02:00 David Shteynberg <
>> [email protected]>:
>>
>> Hi,
>>
>> There may be several things going on here, which will require a new copy
>> of PTMProphet for you to process the results.  I think that you are using
>> an older version of PTMProphet which has seen recent improvements to cover
>> more PTM user cases.  PTMProphet compares the internally calculated mass to
>> the search engine reported mass, these may not agree and cause this problem
>> for the K[142] peptides.  The other peptides are M containing with oxidized
>> Methionine so you PTMProphet settings should include M,15.9949 to make
>> those go away.  If you also send the mzXML file, I can try the latest code
>> on you data.
>>
>>
>> Thanks,
>> -David
>>
>> On Wed, Apr 29, 2015 at 8:16 AM, Delphine <[email protected]> wrote:
>>
>> Hello,
>>
>> I'm trying to use ptmprophet to identify methylation on lysines. First I
>> identify the peptides with comet, xtandem, spectraST and mascot. Here are
>> the lines where the modification is discribed in the xtandem and comet
>> parameter files I used:
>>  comet: variable_mod02 = 14.015650 K 0 3 -1 0
>>  xtandem: <note type="input" label="residue, potential modification
>> mass">15.994915@M,14.015650@K</note>
>>
>> I combine the 4 results with iprophet (file joined)  and tried to use
>> PTMprophet on this file.
>>
>> Here is the command line:
>> * cd /opt/tpp/data/327_05_01; /opt/tpp/bin/PTMProphetParser K,14.0156
>> MZTOL=0.2
>> /opt/tpp/data/327_05_01/327_05_01_020_150417_01_MTCS_0_D_interact.iproph.pep.xml
>> interact.ptm.pep.xml *
>>
>> And here is the error message:
>>
>> INFO: Writing file interact.ptm.pep.xml ...
>> INFO: Reading file 
>> /opt/tpp/data/327_05_01/327_05_01_020_150417_01_MTCS_0_D_interact.iproph.pep.xml
>>  ...WARNING: Illegal peptide with unknown mod: GTAGK[142]VIK[142]WARNING: 
>> Illegal peptide with unknown mod: ILVAIMK[142]WARNING: Illegal peptide with 
>> unknown mod: VTNLHVK[142]WARNING: Illegal peptide with unknown mod: 
>> ALK[142]EPPRWARNING: Illegal peptide with unknown mod: ALK[142]EPPRWARNING: 
>> Illegal peptide with unknown mod: ALK[142]EPPRWARNING: Illegal peptide with 
>> unknown mod: K[142]EGVK[142]PRWARNING: Illegal peptide with unknown mod: 
>> VLEPENK[142]WARNING: Illegal peptide with unknown mod: VLNILEK[142]WARNING: 
>> Illegal peptide with unknown mod: WLVVPDK[142]WARNING: Illegal peptide with 
>> unknown mod: LLLTTPAK[142]WARNING: Illegal peptide with unknown mod: 
>> K[142]PHPPKRWARNING: Illegal peptide with unknown mod: KPHPPK[142]RWARNING: 
>> Illegal peptide with unknown mod: DADFNGTK[142]WARNING: Illegal peptide with 
>> unknown mod: LYSC[160]TPRWARNING: Illegal peptide with unknown mod: 
>> KAVVVC[160]PKWARNING: Illegal peptide with unknown mod: KTPMC[160]EKWARNING: 
>> Illegal peptide with unknown mod: LAALAEALK[142]WARNING: Illegal peptide 
>> with unknown mod: VK[142]THLFRWARNING: Illegal peptide with unknown mod: 
>> MEFLKQKWARNING: Illegal peptide with unknown mod: MDK[142]TFERWARNING: 
>> Illegal peptide with unknown mod: GAGMSFSRKWARNING: Illegal peptide with 
>> unknown mod: ALLVYC[160]VKWARNING: Illegal peptide with unknown mod: 
>> ALLVYC[160]VKWARNING: Illegal peptide with unknown mod: 
>> VFISC[160]K[142]VQWARNING: Illegal peptide with unknown mod: 
>> VMLYPSRIWARNING: Illegal peptide with unknown mod: 
>> MC[160]GDC[160]VEKWARNING: Illegal peptide with unknown mod: 
>> LSLHLSPIK[142]WARNING: Illegal peptide with unknown mod: MSVNISTAGKWARNING: 
>> Illegal peptide with unknown mod: NLMANRPAK[142]WARNING: Illegal peptide 
>> with unknown mod: TAMLLALQRWARNING: Illegal peptide with unknown mod: 
>> LSSC[160]KPPKKWARNING: Illegal peptide with unknown mod: 
>> K[142]QLYPFFKWARNING: Illegal peptide with unknown mod: 
>> KQLYPFFK[142]WARNING: Illegal peptide with unknown mod: 
>> TK[142]LNYNPPKWARNING: Illegal peptide with unknown mod: 
>> TKLNYNPPK[142]WARNING: Illegal peptide with unknown mod: 
>> IIK[142]ALDLPAKWARNING: Illegal peptide with unknown mod: 
>> IIKALDLPAK[142]WARNING: Illegal peptide with unknown mod: 
>> VK[142]PNVAVLSRWARNING: Illegal peptide with unknown mod: 
>> ASSLPSSAPAVK[142]WARNING: Illegal peptide with unknown mod: 
>> SLASSAQPGLGK[142]WARNING: Illegal peptide with unknown mod: 
>> AEMEELMEKWARNING: Illegal peptide with unknown mod: NDC[160]TTQSNVKWARNING: 
>> Illegal peptide with unknown mod: LNK[142]TPIPQTK[142]WARNING: Illegal 
>> peptide with unknown mod: SSLLGTGITSPK[142]WARNING: Illegal peptide with 
>> unknown mod: LIDLC[160]QPTQK[142]WARNING: Illegal peptide with unknown mod: 
>> RNQDRPSLLK[142]WARNING: Illegal peptide with unknown mod: 
>> K[142]RPDEMLLPKWARNING: Illegal peptide with unknown mod: 
>> KRPDEMLLPK[142]WARNING: Illegal peptide with unknown mod: LAERPNIKMRWARNING: 
>> Illegal peptide with unknown mod: K[142]ITGEIMHALKWARNING: Illegal peptide 
>> with unknown mod: KITGEIMHALK[142]WARNING: Illegal peptide with unknown mod: 
>> NVQTPQC[160]K[142]LRWARNING: Illegal peptide with unknown mod: 
>> VGAWGISGEPRK[142]WARNING: Illegal peptide with unknown mod: 
>> DLLHPSPEEEK[142]WARNING: Illegal peptide with unknown mod: 
>> GALGPGGPLGHPGEK[142]WARNING: Illegal peptide with unknown mod: 
>> KAGTVMFEYGMRWARNING: Illegal peptide with unknown mod: REENQNEVNMKWARNING: 
>> Illegal peptide with unknown mod: K[142]NSGC[160]TEVC[160]HTRWARNING: 
>> Illegal peptide with unknown mod: QILLLLPVMINMLK[142]WARNING: Illegal 
>> peptide with unknown mod: QILLLLPVMINMLK[142]WARNING: Illegal peptide with 
>> unknown mod: LQGEGLSVAGIVC[160]HVGKWARNING: Illegal peptide with unknown 
>> mod: SWAEAYK[142]DLENSDEFK[142]WARNING: Illegal peptide with unknown mod: 
>> DLVSGGSNEGNGK[142]EDWAMK[142]WARNING: Illegal peptide with unknown mod: 
>> AVATGKMDENQFVAVTSTNAAKWARNING: Illegal peptide with unknown mod: 
>> LPMASSMEHGK[142]DLPSVQLLMK[142]WARNING: Illegal peptide with unknown mod: 
>> MQILTPPLQSSVELVADPETRWARNING: Illegal peptide with unknown mod: 
>> LTPTEIVLILPMPEQRNSLTAK[142]WARNING: Illegal peptide with unknown mod: 
>> QKLC[160]YVSQGNASFTYGYEYLGC[160]TSRWARNING: Illegal peptide with unknown 
>> mod: DNEIQMDMTLGPIEEAYAILNRFEVEVTK[142]WARNING: Illegal peptide with unknown 
>> mod: QMGQEIGNELDEQNEIIDDLANLVENTDEK[142]WARNING: Illegal peptide with 
>> unknown mod: HLVC[160]SFRLYPFTVHTVSPGNSHLALYQVFK[142]WARNING: Illegal 
>> peptide with unknown mod: 
>> EVK[142]VYLLTTSSAPYC[160]NAFQLLTVAPNHGISLK[142]WARNING: Illegal peptide with 
>> unknown mod: K[142]GNFQLQGTMLSDGQGFTQDDVQAAEVTYGAMARWARNING: Illegal peptide 
>> with unknown mod: EESLHSILAGSDMTVSQILLTQHGIPVMNLSDGK[142]WARNING: Illegal 
>> peptide with unknown mod: DPPAQC[160]SAGPVGDDMFHWQATIMGPISNYMLDNWARNING: 
>> Illegal peptide with unknown mod: 
>> LYC[160]NGDGEWMVPIGRC[160]TC[160]K[142]PGYEPENSVAC[160]KWARNING: Illegal 
>> peptide with unknown mod: 
>> LYC[160]NGDGEWMVPIGRC[160]TC[160]KPGYEPENSVAC[160]K[142]WARNING: Illegal 
>> peptide with unknown mod: ASVDSGNEDIIEALISLFYGVMTPMLNPLIYSLRWARNING: Illegal 
>> peptide with unknown mod: MGFNRPSKIQENALPLMLAEPPQNLIAQSQSGTGKWARNING: 
>> Illegal peptide with unknown mod: 
>> GFPSQC[160]YSAQTLPELC[160]SPQDELDFLMEALIISKWARNING: Illegal peptide with 
>> unknown mod: LYTMDGITVTVADLFFAGTETTSTTLRYGLLILMK[142]WARNING: Illegal 
>> peptide with unknown mod: 
>> FVHKSFVEVNEEGTEAAAASSC[160]FVVAEC[160]C[160]MESGPRWARNING: Illegal peptide 
>> with unknown mod: GPLLAQEMPTVSVLEYALPQRPPQGPEDDRDLSERWARNING: Illegal 
>> peptide with unknown mod: GGEC[160]HGMDAEQEMRWARNING: Illegal peptide with 
>> unknown mod: WAAVMVPSGEEQRWARNING: Illegal peptide with unknown mod: 
>> MTSMMC[160]TVMLK[142]TWARNING: Illegal peptide with unknown mod: 
>> MSFSEMNRWARNING: Illegal peptide with unknown mod: MSFAGTVAWMAPEVIRWARNING: 
>> Illegal peptide with unknown mod: GSQDFSFREIMGSRWARNING: Illegal peptide 
>> with unknown mod: RAVGIWHC[160]GSC[160]MKWARNING: Illegal peptide with 
>> unknown mod: RAVGIWHC[160]GSC[160]MKWARNING: Illegal peptide with unknown 
>> mod: EMSEEMDK[142]WARNING: Illegal peptide with unknown mod: 
>> RAVGIWHC[160]GSC[160]MKWARNING: Illegal peptide with unknown mod: 
>> MVLLAGTGPEGGGARWARNING: Illegal peptide with unknown mod: 
>> QDFNMMEQRK[142]WARNING: Illegal peptide with unknown mod: 
>> MEAMGEWNPNVKWARNING: Illegal peptide with unknown mod: 
>> AVGIWHC[160]GSC[160]MKWARNING: Illegal peptide with unknown mod: 
>> TK[142]EMDVYGITDKWARNING: Illegal peptide with unknown mod: 
>> TKEMDVYGITDK[142]WARNING: Illegal peptide with unknown mod: 
>> RAVGIWHC[160]GSC[160]MKWARNING: Illegal peptide with unknown mod: 
>> RAVGIWHC[160]GSC[160]MKWARNING: Illegal peptide with unknown mod: 
>> VMAMAIDYRWARNING: Illegal peptide with unknown mod: 
>> RAVGIWHC[160]GSC[160]MKWARNING: Illegal peptide with unknown mod: 
>> AVGIWHC[160]GSC[160]MKWARNING: Illegal peptide with unknown mod: 
>> AVGIWHC[160]GSC[160]MKWARNING: Illegal peptide with unknown mod: 
>> RAVGIWHC[160]GSC[160]MKWARNING: Illegal peptide with unknown mod: 
>> IKFEMEQNLRWARNING: Illegal peptide with unknown mod: MNGLRNKWARNING: Illegal 
>> peptide with unknown mod: RAVGIWHC[160]GSC[160]MKWARNING: Illegal peptide 
>> with unknown mod: AVGIWHC[160]GSC[160]MKWARNING: Illegal peptide with 
>> unknown mod: AVGIWHC[160]GSC[160]MKWARNING: Illegal peptide with unknown 
>> mod: AVGIWHC[160]GSC[160]MKWARNING: Illegal peptide with unknown mod: 
>> RAVGIWHC[160]GSC[160]MKWARNING: Illegal peptide with unknown mod: 
>> VMLYPSRWARNING: Illegal peptide with unknown mod: 
>> RAVGIWHC[160]GSC[160]MKWARNING: Illegal peptide with unknown mod: 
>> VMLYPSRWARNING: Illegal peptide with unknown mod: KLIMEAMKWARNING: Illegal 
>> peptide with unknown mod: MC[160]GDC[160]VEKWARNING: Illegal peptide with 
>> unknown mod: SESMDYSRWARNING: Illegal peptide with unknown mod: 
>> GMPGGRNLYKWARNING: Illegal peptide with unknown mod: 
>> AVGIWHC[160]GSC[160]MKWARNING: Illegal peptide with unknown mod: 
>> RAVGIWHC[160]GSC[160]MKWARNING: Illegal peptide with unknown mod: 
>> MNAFYDAQVEFVKWARNING: Illegal peptide with unknown mod: IITVMSMGMKWARNING: 
>> Illegal peptide with unknown mod: LNIFDMMAVTKWARNING: Illegal peptide with 
>> unknown mod: RAVGIWHC[160]GSC[160]MKWARNING: Illegal peptide with unknown 
>> mod: DVDNAYMIKWARNING: Illegal peptide with unknown mod: 
>> RAVGIWHC[160]GSC[160]MKWARNING: Illegal peptide with unknown mod: 
>> MNWENESSPKWARNING: Illegal peptide with unknown mod: LNIFDMMAVTKWARNING: 
>> Illegal peptide with unknown mod: YYADGEDAYAMKWARNING: Illegal peptide with 
>> unknown mod: APAMFNIRWARNING: Illegal peptide with unknown mod: 
>> RAVGIWHC[160]GSC[160]MKWARNING: Illegal peptide with unknown mod: 
>> APAMFNIRWARNING: Illegal peptide with unknown mod: GFMVQTGDPTGTGRWARNING: 
>> Illegal peptide with unknown mod: RAVGIWHC[160]GSC[160]MKWARNING: Illegal 
>> peptide with unknown mod: MTLDDFRWARNING: Illegal peptide with unknown mod: 
>> RAVGIWHC[160]GSC[160]MKWARNING: Illegal peptide with unknown mod: 
>> RAVGIWHC[160]GSC[160]MKWARNING: Illegal peptide with unknown mod: 
>> QVLDNLTMEKWARNING: Illegal peptide with unknown mod: QVLDNLTMEKWARNING: 
>> Illegal peptide with unknown mod: RAVGIWHC[160]GSC[160]MKWARNING: Illegal 
>> peptide with unknown mod: RAVGIWHC[160]GSC[160]MKWARNING: Illegal peptide 
>> with unknown mod: QVLDNLTMEKWARNING: Illegal peptide with unknown mod: 
>> NTPGFMYK[142]WARNING: Illegal peptide with unknown mod: 
>> RAVGIWHC[160]GSC[160]MKWARNING: Illegal peptide with unknown mod: 
>> RAVGIWHC[160]GSC[160]MKWARNING: Illegal peptide with unknown mod: 
>> RAVGIWHC[160]GSC[160]MKWARNING: Illegal peptide with unknown mod: EGML
>>
>> ...
>
> --
> You received this message because you are subscribed to the Google Groups
> "spctools-discuss" group.
> To unsubscribe from this group and stop receiving emails from it, send an
> email to [email protected].
> To post to this group, send email to [email protected].
> Visit this group at https://groups.google.com/group/spctools-discuss.
> For more options, visit https://groups.google.com/d/optout.
>

-- 
You received this message because you are subscribed to the Google Groups 
"spctools-discuss" group.
To unsubscribe from this group and stop receiving emails from it, send an email 
to [email protected].
To post to this group, send email to [email protected].
Visit this group at https://groups.google.com/group/spctools-discuss.
For more options, visit https://groups.google.com/d/optout.

Reply via email to