Hi Adam,
I think the error may come from the beginning as *sp>* is written
instead of *>sp*
I hope it will help you.
*Fred*
Le 29/09/2017 à 05:40, Adam R a écrit :
Hi Everyone,
I am trying to assemble a customized fasta database to search spectra
against. I believe I had the correct format as:
sp>|Q13547|HDAC1_HUMAN Histone deacetylase 1 OS=Homo sapiens GN=HDAC1
PE=1 SV=1
MAQTQGTRRKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKAN
AEEMTKYHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVAS
AVKLNKQQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHG
DGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNYPLRDGIDDESYEAI
FKPVMSKVMEMFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNLPMLMLGG
GGYTIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLE
KIKQRLFENLRMLPHAPGVQMQAIPEDAIPEESGDEDEDDPDKRISICSSDKRIACEEEF
SDSEEEGEGGRKNSSNFKKAKRVKTEDEKEKDPEEKKEVTEEEKTKEEKPEAKGVKEEVK
LA
With all over the other proteins following the same format. I haven't
had issues with the past when copying and pasting in sequences from
the GPM crapome database
so I am not sure what is wrong about it...
Thanks,
Adam
--
You received this message because you are subscribed to the Google
Groups "spctools-discuss" group.
To unsubscribe from this group and stop receiving emails from it, send
an email to [email protected]
<mailto:[email protected]>.
To post to this group, send email to [email protected]
<mailto:[email protected]>.
Visit this group at https://groups.google.com/group/spctools-discuss.
For more options, visit https://groups.google.com/d/optout.
--
*Frédéric DELOLME*
/Protein Science Facility
Service de Spectrométrie de masse
IBCP - 7, passage du Vercors 69367 LYON Cedex 07 - FRANCE
Tél : +33(0)4 72 72 26 93 - Fax : +33(0)4 72 72 26 04/
//
--
You received this message because you are subscribed to the Google Groups
"spctools-discuss" group.
To unsubscribe from this group and stop receiving emails from it, send an email
to [email protected].
To post to this group, send email to [email protected].
Visit this group at https://groups.google.com/group/spctools-discuss.
For more options, visit https://groups.google.com/d/optout.
