Woops. Yes this is my mistake when copying/pasting into the post. But the the fasta file attached is correct with >sp|uniprot|gene_human for all entries.
Adam On Friday, September 29, 2017 at 9:04:09 AM UTC-5, Eric Deutsch wrote: > > Greater than symbol should be first on the line. Instead of: > > > > sp>|Q13547|HDAC1_HUMAN > > > > must be: > > > > >sp|Q13547|HDAC1_HUMAN > > > > Eric > > > > > > *From:* [email protected] <javascript:> [mailto: > [email protected] <javascript:>] *On Behalf Of *Adam R > *Sent:* Thursday, September 28, 2017 8:41 PM > *To:* spctools-discuss <[email protected] <javascript:>> > *Subject:* [spctools-discuss] "- Search progress: Error - database file, > expecting definition line here." Error with custom database > > > > Hi Everyone, > > I am trying to assemble a customized fasta database to search spectra > against. I believe I had the correct format as: > > sp>|Q13547|HDAC1_HUMAN Histone deacetylase 1 OS=Homo sapiens GN=HDAC1 PE=1 > SV=1 > > MAQTQGTRRKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKAN > > AEEMTKYHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVAS > > AVKLNKQQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHG > > DGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNYPLRDGIDDESYEAI > > FKPVMSKVMEMFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNLPMLMLGG > > GGYTIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLE > > KIKQRLFENLRMLPHAPGVQMQAIPEDAIPEESGDEDEDDPDKRISICSSDKRIACEEEF > > SDSEEEGEGGRKNSSNFKKAKRVKTEDEKEKDPEEKKEVTEEEKTKEEKPEAKGVKEEVK > > LA > > > > With all over the other proteins following the same format. I haven't had > issues with the past when copying and pasting in sequences from the GPM > crapome database > > so I am not sure what is wrong about it... > > Thanks, > > Adam > > -- > You received this message because you are subscribed to the Google Groups > "spctools-discuss" group. > To unsubscribe from this group and stop receiving emails from it, send an > email to [email protected] <javascript:>. > To post to this group, send email to [email protected] > <javascript:>. > Visit this group at https://groups.google.com/group/spctools-discuss. > For more options, visit https://groups.google.com/d/optout. > -- You received this message because you are subscribed to the Google Groups "spctools-discuss" group. To unsubscribe from this group and stop receiving emails from it, send an email to [email protected]. To post to this group, send email to [email protected]. Visit this group at https://groups.google.com/group/spctools-discuss. For more options, visit https://groups.google.com/d/optout.
