Woops. Yes this is my mistake when copying/pasting into the post. But the 
the fasta file attached is correct with >sp|uniprot|gene_human for all 
entries.

Adam


On Friday, September 29, 2017 at 9:04:09 AM UTC-5, Eric Deutsch wrote:
>
> Greater than symbol should be first on the line. Instead of:
>
>  
>
> sp>|Q13547|HDAC1_HUMAN
>
>  
>
> must be:
>
>  
>
> >sp|Q13547|HDAC1_HUMAN
>
>  
>
> Eric
>
>  
>
>  
>
> *From:* [email protected] <javascript:> [mailto:
> [email protected] <javascript:>] *On Behalf Of *Adam R
> *Sent:* Thursday, September 28, 2017 8:41 PM
> *To:* spctools-discuss <[email protected] <javascript:>>
> *Subject:* [spctools-discuss] "- Search progress: Error - database file, 
> expecting definition line here." Error with custom database
>
>  
>
> Hi Everyone,
>
> I am trying to assemble a customized fasta database to search spectra 
> against. I believe I had the correct format as: 
>
> sp>|Q13547|HDAC1_HUMAN Histone deacetylase 1 OS=Homo sapiens GN=HDAC1 PE=1 
> SV=1
>
> MAQTQGTRRKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKAN
>
> AEEMTKYHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVAS
>
> AVKLNKQQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHG
>
> DGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNYPLRDGIDDESYEAI
>
> FKPVMSKVMEMFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNLPMLMLGG
>
> GGYTIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLE
>
> KIKQRLFENLRMLPHAPGVQMQAIPEDAIPEESGDEDEDDPDKRISICSSDKRIACEEEF
>
> SDSEEEGEGGRKNSSNFKKAKRVKTEDEKEKDPEEKKEVTEEEKTKEEKPEAKGVKEEVK
>
> LA
>
>  
>
> With all over the other proteins following the same format. I haven't had 
> issues with the past when copying and pasting in sequences from the GPM 
> crapome database
>
> so I am not sure what is wrong about it...
>
> Thanks,
>
> Adam
>
> -- 
> You received this message because you are subscribed to the Google Groups 
> "spctools-discuss" group.
> To unsubscribe from this group and stop receiving emails from it, send an 
> email to [email protected] <javascript:>.
> To post to this group, send email to [email protected] 
> <javascript:>.
> Visit this group at https://groups.google.com/group/spctools-discuss.
> For more options, visit https://groups.google.com/d/optout.
>

-- 
You received this message because you are subscribed to the Google Groups 
"spctools-discuss" group.
To unsubscribe from this group and stop receiving emails from it, send an email 
to [email protected].
To post to this group, send email to [email protected].
Visit this group at https://groups.google.com/group/spctools-discuss.
For more options, visit https://groups.google.com/d/optout.

Reply via email to