Adam, Try removing the first blank line in your fasta file and see if that fixes the problem.
On Fri, Sep 29, 2017 at 8:06 AM, Adam R <[email protected]> wrote: > Woops. Yes this is my mistake when copying/pasting into the post. But the > the fasta file attached is correct with >sp|uniprot|gene_human for all > entries. > > Adam > > > On Friday, September 29, 2017 at 9:04:09 AM UTC-5, Eric Deutsch wrote: >> >> Greater than symbol should be first on the line. Instead of: >> >> >> >> sp>|Q13547|HDAC1_HUMAN >> >> >> >> must be: >> >> >> >> >sp|Q13547|HDAC1_HUMAN >> >> >> >> Eric >> >> >> >> >> >> *From:* [email protected] [mailto:[email protected]] >> *On Behalf Of *Adam R >> *Sent:* Thursday, September 28, 2017 8:41 PM >> *To:* spctools-discuss <[email protected]> >> *Subject:* [spctools-discuss] "- Search progress: Error - database file, >> expecting definition line here." Error with custom database >> >> >> >> Hi Everyone, >> >> I am trying to assemble a customized fasta database to search spectra >> against. I believe I had the correct format as: >> >> sp>|Q13547|HDAC1_HUMAN Histone deacetylase 1 OS=Homo sapiens GN=HDAC1 >> PE=1 SV=1 >> >> MAQTQGTRRKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKAN >> >> AEEMTKYHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVAS >> >> AVKLNKQQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHG >> >> DGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNYPLRDGIDDESYEAI >> >> FKPVMSKVMEMFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNLPMLMLGG >> >> GGYTIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLE >> >> KIKQRLFENLRMLPHAPGVQMQAIPEDAIPEESGDEDEDDPDKRISICSSDKRIACEEEF >> >> SDSEEEGEGGRKNSSNFKKAKRVKTEDEKEKDPEEKKEVTEEEKTKEEKPEAKGVKEEVK >> >> LA >> >> >> >> With all over the other proteins following the same format. I haven't had >> issues with the past when copying and pasting in sequences from the GPM >> crapome database >> >> so I am not sure what is wrong about it... >> >> Thanks, >> >> Adam >> >> -- >> You received this message because you are subscribed to the Google Groups >> "spctools-discuss" group. >> To unsubscribe from this group and stop receiving emails from it, send an >> email to [email protected]. >> To post to this group, send email to [email protected]. >> Visit this group at https://groups.google.com/group/spctools-discuss. >> For more options, visit https://groups.google.com/d/optout. >> > -- > You received this message because you are subscribed to the Google Groups > "spctools-discuss" group. > To unsubscribe from this group and stop receiving emails from it, send an > email to [email protected]. > To post to this group, send email to [email protected]. > Visit this group at https://groups.google.com/group/spctools-discuss. > For more options, visit https://groups.google.com/d/optout. > -- You received this message because you are subscribed to the Google Groups "spctools-discuss" group. To unsubscribe from this group and stop receiving emails from it, send an email to [email protected]. To post to this group, send email to [email protected]. Visit this group at https://groups.google.com/group/spctools-discuss. For more options, visit https://groups.google.com/d/optout.
