Adam,

Try removing the first blank line in your fasta file and see if that fixes
the problem.

On Fri, Sep 29, 2017 at 8:06 AM, Adam R <[email protected]> wrote:

> Woops. Yes this is my mistake when copying/pasting into the post. But the
> the fasta file attached is correct with >sp|uniprot|gene_human for all
> entries.
>
> Adam
>
>
> On Friday, September 29, 2017 at 9:04:09 AM UTC-5, Eric Deutsch wrote:
>>
>> Greater than symbol should be first on the line. Instead of:
>>
>>
>>
>> sp>|Q13547|HDAC1_HUMAN
>>
>>
>>
>> must be:
>>
>>
>>
>> >sp|Q13547|HDAC1_HUMAN
>>
>>
>>
>> Eric
>>
>>
>>
>>
>>
>> *From:* [email protected] [mailto:[email protected]]
>> *On Behalf Of *Adam R
>> *Sent:* Thursday, September 28, 2017 8:41 PM
>> *To:* spctools-discuss <[email protected]>
>> *Subject:* [spctools-discuss] "- Search progress: Error - database file,
>> expecting definition line here." Error with custom database
>>
>>
>>
>> Hi Everyone,
>>
>> I am trying to assemble a customized fasta database to search spectra
>> against. I believe I had the correct format as:
>>
>> sp>|Q13547|HDAC1_HUMAN Histone deacetylase 1 OS=Homo sapiens GN=HDAC1
>> PE=1 SV=1
>>
>> MAQTQGTRRKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKAN
>>
>> AEEMTKYHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVAS
>>
>> AVKLNKQQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHG
>>
>> DGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNYPLRDGIDDESYEAI
>>
>> FKPVMSKVMEMFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNLPMLMLGG
>>
>> GGYTIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLE
>>
>> KIKQRLFENLRMLPHAPGVQMQAIPEDAIPEESGDEDEDDPDKRISICSSDKRIACEEEF
>>
>> SDSEEEGEGGRKNSSNFKKAKRVKTEDEKEKDPEEKKEVTEEEKTKEEKPEAKGVKEEVK
>>
>> LA
>>
>>
>>
>> With all over the other proteins following the same format. I haven't had
>> issues with the past when copying and pasting in sequences from the GPM
>> crapome database
>>
>> so I am not sure what is wrong about it...
>>
>> Thanks,
>>
>> Adam
>>
>> --
>> You received this message because you are subscribed to the Google Groups
>> "spctools-discuss" group.
>> To unsubscribe from this group and stop receiving emails from it, send an
>> email to [email protected].
>> To post to this group, send email to [email protected].
>> Visit this group at https://groups.google.com/group/spctools-discuss.
>> For more options, visit https://groups.google.com/d/optout.
>>
> --
> You received this message because you are subscribed to the Google Groups
> "spctools-discuss" group.
> To unsubscribe from this group and stop receiving emails from it, send an
> email to [email protected].
> To post to this group, send email to [email protected].
> Visit this group at https://groups.google.com/group/spctools-discuss.
> For more options, visit https://groups.google.com/d/optout.
>

-- 
You received this message because you are subscribed to the Google Groups 
"spctools-discuss" group.
To unsubscribe from this group and stop receiving emails from it, send an email 
to [email protected].
To post to this group, send email to [email protected].
Visit this group at https://groups.google.com/group/spctools-discuss.
For more options, visit https://groups.google.com/d/optout.

Reply via email to