Hi Mohammad,
I think this is outside the scope of this mailing list. Regards, Guillermo ________________________________ From: Mohammad Goodarzi <[email protected]> Sent: Thursday, March 22, 2018 4:09 PM To: [email protected] Subject: [Xplor-nih] how to generate random sequences Hello, I would like to know how to generate random sequences from a given region of a protein This is the sequence of my protein MEEKLKKTKIIFVVGGPGSGKGTQCEKIVQKYGYTHLSTGDLLRSEVSSGSARGKKLSEI MEKGQLVPLETVLDMLRDAMVAKVNTSKGFLIDGYPREVQQGEEFERRIGQPTLLLYVDA GPETMTQRLLKRGETSGRVDDNEETIKKRLETYYKATEPVIAFYEKRGIVRKVNAEGSVD SVFSQVCTHLDALK I want to generate random sequences from two different regions This is one of the region TGDLLRSEVSSGSARGKKLSEI This is another region KATEPVIAFYEKRGIVRKVNAE Thanks, Mohammad
_______________________________________________ Xplor-nih mailing list [email protected] https://dcb.cit.nih.gov/mailman/listinfo/xplor-nih
