Hello Mohammad-- > > I would like to know how to generate random sequences from a given region of a > protein > > This is the sequence of my protein > > MEEKLKKTKIIFVVGGPGSGKGTQCEKIVQKYGYTHLSTGDLLRSEVSSGSARGKKLSEI > MEKGQLVPLETVLDMLRDAMVAKVNTSKGFLIDGYPREVQQGEEFERRIGQPTLLLYVDA > GPETMTQRLLKRGETSGRVDDNEETIKKRLETYYKATEPVIAFYEKRGIVRKVNAEGSVD > SVFSQVCTHLDALK > > I want to generate random sequences from two different regions > > This is one of the region > > TGDLLRSEVSSGSARGKKLSEI >
This is a little scripting problem for you which is fairly straightforward. Do you really want the sequence to be random? Do you wish to sample all permutations? This snippet will permute a string, in this case the string 'abc' Charles _______________________________________________ Xplor-nih mailing list [email protected] https://dcb.cit.nih.gov/mailman/listinfo/xplor-nih
