Hello, Yes, I wish to do that , all possible random sequences
Best Regards, Mohammad On Thu, Mar 22, 2018 at 8:41 PM, Charles Schwieters <[email protected]> wrote: > > Hello Mohammad-- > > > > > I would like to know how to generate random sequences from a given > region of a > > protein > > > > This is the sequence of my protein > > > > MEEKLKKTKIIFVVGGPGSGKGTQCEKIVQKYGYTHLSTGDLLRSEVSSGSARGKKLSEI > > MEKGQLVPLETVLDMLRDAMVAKVNTSKGFLIDGYPREVQQGEEFERRIGQPTLLLYVDA > > GPETMTQRLLKRGETSGRVDDNEETIKKRLETYYKATEPVIAFYEKRGIVRKVNAEGSVD > > SVFSQVCTHLDALK > > > > I want to generate random sequences from two different regions > > > > This is one of the region > > > > TGDLLRSEVSSGSARGKKLSEI > > > > This is a little scripting problem for you which is fairly > straightforward. Do you really want the sequence to be random? Do you > wish to sample all permutations? This snippet will permute a string, > in this case the string 'abc' > > Charles >
_______________________________________________ Xplor-nih mailing list [email protected] https://dcb.cit.nih.gov/mailman/listinfo/xplor-nih
