On Thu, 15 Jan 2004 15:37:31 +0000, Derek Gatherer wrote: > Hi > I think my question yesterday wasn't very clear, sorry. What I'm on about > is the default effects of /gene, /product, /note and /label. For instance:
> misc_feature 1..578 > /note="sequence a; terminal redundancy" > repeat_region 1..11247 > /note="TRL; inverted" > /rpt_type=terminal > CDS 970..1905 > /codon_start=1 > /gene="this is a gene" > /product="this is a product" > /label="this is a label" > /note="this is a note" > /protein_id="NP_783767.1" > /db_xref="GI:28373215" > /translation="MPATDTNSTHTTPLHPDAQHTLPLHHSNTQPHVQTSDKHADEEH > RTQMELDAADYAACAQARQHLYDQTQPLLLAYPNTNPQDSAHFPTENQHQLTHPLHNI > GEGAALGYPVPRAEIRRGGGDWADSASDFDADCWCMWGRFGTMGRQPVVTLLLARQRD > GLADWNVVRCRGTGFRAHDSEDGVSVWRQHLVFLL > As far as I can see, only /gene annotates the turquoise CDS bars. /note > gives annotation visible in the feature table. /product and /label don't > automatically do anything (like protein_id or db_xref). Is this what > should be seen or have I misconfigured something? (I'm running Artemis 5 on > a Compaq Tru64 - I've considerably hacked about with the Graph and Run > menus, but not done anything that I think would damage the display). Hi. I'm slightly confused by that. In Artemis V5, if there is a /label and a /gene, the /label takes priority - the /label is the one that's shown under the CDS on screen. If there is no /label, the /gene is shown. This has been changed in the development version so that /gene has priority. The /product isn't shown on screen unless you switch on the "Show Products" toggle in the popup menu of the feature list. Kim.
