[artemis-users] turning /label into annotation

[Derek Gatherer]

Hi

I have a genome annotated with /product and /label in the feature table.

eg:

 primer_bind     80929..80945
                     /note="PRIMER U54s8"
                     /label=U54s8
     primer_bind     complement(81373..81393)
                     /label=U54P5
                     /note="PRIMER U54P5"
     CDS             complement(81703..84423)
                     /note="envelope glycoprotein; HSV-1 UL27 counterpart; gB"
                     /codon_start=1
                     /product="UL55"
                     /protein_id="NP_039989.1"
                     /db_xref="GI:9625740"
                     /translation="MESRIWCLVVCVNLCIVCLGAAVSSSSTSHATSSTHNGSHTSRT
                     TSAQTRSVYSQHVTSSEAVSHRANETIYNTTLKYGDVVGVNTTKYPYRVCSMAQGTDL
                     IRFERNIICTSMKPINEDLDE
How can I make those /label annotations appear in the viewer underneath the 
corresponding CDS?  So the gene above would be instantly visible as UL55, 
and the nearby primer binding site as U54P5?

I tried "Automatically Create Gene Names" and "Fix Gene Names", but the 
first wanted to add new annotation and the second seemed to assume that all 
gene name were "CDS" (and gave an endless series of popups saying that CDS 
overlapped with another gene called CDS).

As always, all help gratefully received.

Cheers
Derek
_________________________
Derek Gatherer Ph.D. Cert.Ed.
Computer Officer
Institute of Virology
Church St.
Glasgow G11 5JR
Phone:      +44 141 330 6268
Fax:          +44 141 337 2236
Email:        [EMAIL PROTECTED]
Website:    http://www.vir.gla.ac.uk