Re: Why was apache2's logfiles moved mid april?

On Mon, 5 Jun 2017, Gene Heskett wrote: Greetings all; 100% uptodate wheezy install here. I try to keep a handle on my web site traffic with awffull, but it has not generated any new data since sometime in april, so I go looking for the why tonight and find that apache2's logfiles were moved

Re: Adding Date & Time to a script's output log

On Thu, 1 Jun 2017, Greg Wooledge wrote: On Thu, Jun 01, 2017 at 06:49:58PM +, david...@freevolt.org wrote: If you go this convenient-lexical-order route, note that %F is shorthand for %Y-%m-%d Not portable. See

Re: Adding Date & Time to a script's output log

On Thu, 1 Jun 2017, Nicolas George wrote: Le tridi 13 prairial, an CCXXV, SUZANNE COBB a écrit : I try to capture the date and time into a variable named 'dt': dt= $(date '+%d/%m/%Y %H:%M:%S'); Note that %T is shorthand for %H:%M:%S [please see there is a space between = and $, and

Re: converting my local site to be https only access

On Sun, 30 Apr 2017, Gene Heskett wrote: On Sunday 30 April 2017 20:19:21 david...@freevolt.org wrote: On Sun, 30 Apr 2017, Gene Heskett wrote: [trimmed] lynx support at lynx.isc.org has been deleted. And it won't work without talking to isc.org first. Even after being re-installed. Lynx

Re: converting my local site to be https only access

On Mon, 1 May 2017, Lisi Reisz wrote: On Monday 01 May 2017 01:19:21 david...@freevolt.org wrote: Development of lynx continues unabated: http://invisible-island.net/lynx/lynx-develop.html The most recent reference seems to be to 2015: "Finally (as of 2015) " I linked to that page

Re: converting my local site to be https only access

On Sun, 30 Apr 2017, Gene Heskett wrote: On Saturday 29 April 2017 14:49:04 Gene Heskett wrote: On Saturday 29 April 2017 14:21:27 Jochen Spieker wrote: Gene Heskett: On Saturday 29 April 2017 04:05:01 Felix Dietrich wrote: Gene Heskett writes: Where can I find a

Re: Efficiently finding information 'known' to exist "somewhere"

On Wed, 19 Apr 2017, Richard Owlett wrote: I've had two instances recently. I've found the "immediately" needed information, but they are samples of more generic problems. 1. Today's problem was easily solved. I had seen a post discussing an application of the "tree" command. When I tried

Re: ssl isues are Eating me alive.

On Fri, 14 Apr 2017, Reco wrote: Hi. On Thu, Apr 13, 2017 at 01:01:24PM -0400, Greg Wooledge wrote: On Thu, Apr 13, 2017 at 11:54:32AM -0500, Martin McCormick wrote: This started out a year or so ago with the occasional site in which lynx would report that it was unable to establish

Re: TTL expired in transit to qemu virtual machine.

On Mon, 20 Mar 2017, Mimiko wrote: On 18.03.2017 07:22, Igor Cicimov wrote: >uname -a Linux 3.2.0-4-amd64 #1 SMP Debian 3.2.84-1 x86_64 GNU/Linux That's an really old kernel, I don't start anything virtual these days without at least 3.13.x kernel. I regularly do apt-get upgrade,

Re: Suitable text editor [NOT word processor] or workaround?

On Fri, 17 Mar 2017, david...@freevolt.org wrote: In case OP decides to install emacs, given his previously expressed appreciation of fine documentation, I recommend installing also (for the chosen version NN of emacs) the emacsNN-common-non-dfsg package from the non-free repository. This is

Re: Suitable text editor [NOT word processor] or workaround?

On Thu, 16 Mar 2017, John Hasler wrote: Richard Owlett writes: I require two things: 1. a search and replace which can include a "newline" in new string. 2. display/edit 2 files simultaneously *side by side* Emacs. In case OP decides to install emacs, given his previously expressed

Re: apache2 security update

On Mon, 27 Feb 2017, Dr. John A. Zoidberg MD wrote: This post concerns: Debian Security Advisory DSA-3796-1 (appended below) The package involved is apache2. I have two "live" internet webservers, one an uptodate jessie, the other a long-maintained wheezy. The jessie machine upgraded easily

Re: apt-get is not following preferences.d

On Fri, 27 Jan 2017, Michael Lange wrote: On Fri, 27 Jan 2017 07:00:19 +0100 Matthias Bodenbinder wrote: I created that file with this line but it does not help. Still the same odd pinning after boot. So my problem might not be related to /etc/cron.daily/apt. I

Re: apt-get is not following preferences.d

On Fri, 27 Jan 2017, Matthias Bodenbinder wrote: Am 25.01.2017 um 20:04 schrieb Michael Lange: Hi, On Wed, 25 Jan 2017 07:18:07 +0100 Matthias Bodenbinder wrote: (...) I do not have that file /etc/apt/apt.conf.d/02periodic. I put /etc/cron.daily/apt back where it

online debian man pages back up

https://lists.debian.org/debian-www/2016/12/msg00011.html ...and there was much rejoicing! https://manpages.debian.org/

Re: BRIGHTNESS LEVEL FIXED ON SONY VAIO VPCEH38FN

On Wed, 16 Nov 2016, Atish Pandey wrote: Hello everyone, I am new to Debian, and have recently installed Debian 8.6 Jessie GNOME 3.0 on my sony vaio VPCEH38FN. It has a Nvidia Geforce 410 M graphics card. The issue is that the screen brightness is set to maximum and it is not changing by

Re: apt-get changelog is unsuccessful, but changelog exists

On Tue, 8 Nov 2016, Brian wrote: On Mon 07 Nov 2016 at 18:17:05 -0600, David Wright wrote: On Mon 07 Nov 2016 at 23:24:31 (+), Brian wrote: Something for people to get their teeth into. From the first post: > apt-get changelog libxslt1.1 > Err Changelog for libxslt1.1

Re: looking for a piece of software that will take an url (say to a blog post) and email me the contents

On Wed, 9 Nov 2016, david...@freevolt.org wrote: On Sat, 5 Nov 2016, Dan Hitt wrote: Thanks Miles (and also Dan P and Celejar for other solutions). Indeed Firefox has an archive format (maybe called 'maff'?), but how could you mail it to yourself? That is, how could you mail the maff

Re: looking for a piece of software that will take an url (say to a blog post) and email me the contents

On Wed, 9 Nov 2016, david...@freevolt.org wrote: See http://lynx.invisible-island.net/lynx_help/cattoc.html#header007 ...or the extensive comments on the EXTERNAL variable in /etc/lynx-cur/lynx.cfg

Re: looking for a piece of software that will take an url (say to a blog post) and email me the contents

On Sat, 5 Nov 2016, Dan Hitt wrote: Thanks Miles (and also Dan P and Celejar for other solutions). Indeed Firefox has an archive format (maybe called 'maff'?), but how could you mail it to yourself? That is, how could you mail the maff without taking your hands off the keyboard, or switching

Re: apt-get changelog is unsuccessful, but changelog exists

On Sat, 5 Nov 2016, Brian wrote: On Sat 05 Nov 2016 at 19:06:49 +, david...@freevolt.org wrote: Running... $ apt-get changelog UPGRADEABLE_PACKAGE ...on a wheezy system pointed at these sources... $ grep '^deb ' /etc/apt/sources.list deb http://debian.univ-lorraine.fr/debian/

Re: apt-get changelog is unsuccessful, but changelog exists

On Sat, 5 Nov 2016, david...@freevolt.org wrote: [snip] In the example above, I sought to read a description of the differences between my currently installed libxslt1.1 package, and the more recent available version. Instead, to obtain changelogs, the 8-step workflow outlined below is typical

apt-get changelog is unsuccessful, but changelog exists

Running... $ apt-get changelog UPGRADEABLE_PACKAGE ...on a wheezy system pointed at these sources... $ grep '^deb ' /etc/apt/sources.list deb http://debian.univ-lorraine.fr/debian/ wheezy-updates main deb http://debian.univ-lorraine.fr/debian/ wheezy main deb

Re: url redirected in chrome/chromium, but working fine, according to ping/traceroute, lynx, w3m, iceweasel.

On Fri, 7 Oct 2016, david...@freevolt.org wrote: On Fri, 7 Oct 2016, Tony Baldwin wrote: I have a little business card website up for my big brother's media consulting side-business at http://playomatic.myownsite.me. Now, at the moment, if I try to load it in Google-Chrome-Stable, I'm

Re: url redirected in chrome/chromium, but working fine, according to ping/traceroute, lynx, w3m, iceweasel.

On Fri, 7 Oct 2016, Tony Baldwin wrote: I have a little business card website up for my big brother's media consulting side-business at http://playomatic.myownsite.me. Now, at the moment, if I try to load it in Google-Chrome-Stable, I'm getting redirected to a yahoo! search for "create web",

Re: Typing Cyrillic script with a UK keyboard in an en-gb setting

On Sun, 25 Sep 2016, Brian wrote: On Sat 24 Sep 2016 at 15:07:10 +, david...@freevolt.org wrote: On Sat, 24 Sep 2016, Lisi Reisz wrote: My husband has just asked to do this. His system is vanilla from this point of view. (Mine is in a mess, with a messed-up scim and no foreign fonts

Re: Scroll Lock on VT prevents reboot/shutdown

Some caveats, below, qualifying the claims in my previous reply to OP. On Fri, 30 Sep 2016, david...@freevolt.org wrote: On Thu, 29 Sep 2016, Matt Sickler wrote: [intro cut away] Here's how to replicate the bug: 1) Log in as a normal user on a VT/ 2) Start nano. If nano is

Re: Scroll Lock on VT prevents reboot/shutdown

On Thu, 29 Sep 2016, Matt Sickler wrote: [intro cut away] Here's how to replicate the bug: 1) Log in as a normal user on a VT/ 2) Start nano. If nano is not available, I think any application that interacts with the user would work, but I've only tried using

Re: A psgmlx that plays nice with emacs24?

Hi Bob. On Tue, 27 Sep 2016, Bob Bernstein wrote: Oh Lord I don't have time for this. Neither do some others, and understandably so. But it happens I do, at the moment. Look, I thought I'd take a shot in the dark to see if just maybe someone who knew what psgmlx was might see my Subject:

Re: A psgmlx that plays nice with emacs24?

Hi Bob. A few meta-suggestions are below. On Tue, 27 Sep 2016, Bob Bernstein wrote: I think (hope) the subject says it all. Your RELEASE: You have left unsaid what version of debian you are using. Jessie? Wheezy? Something else? Something else not debian? This matters. Your GOAL: You

Re: usb permission denied

On Tue, 27 Sep 2016, Ric Moore wrote: libusb requires write access to USB device nodes. libusb couldn't open USB device /dev/bus/usb/001/006: Permission denied. If anyone can assist, I'd love to fix this. Ric You know the drill. For posterity's sake, can you provide more context? What are

Re: Typing Cyrillic script with a UK keyboard in an en-gb setting

On Sat, 24 Sep 2016, Lisi Reisz wrote: My husband has just asked to do this. His system is vanilla from this point of view. (Mine is in a mess, with a messed-up scim and no foreign fonts "working", but that is another story.) Advice please on the best way to achieve this for him. I.e., what

Re: Need a tutorial

On Thu, 22 Sep 2016, Gene Heskett wrote: On Thursday 22 September 2016 08:06:34 Lars Noodén wrote: OpenSSH 6.5 or later will support it. Wheezy had 6.0 (but 6.6 is in the backports), and Jessia has 6.7, and Stretch is getting 7.3. The release notes for 6.5 just mention that it is "better"

Re: WordPress on Debian

On Mon, 19 Sep 2016, Kent West wrote: On Mon, Sep 19, 2016 at 11:53 AM, Tony Baldwin wrote: On 09/19/2016 12:26 PM, Miles Fidelman wrote: On 9/19/16 12:20 PM, Tony Baldwin wrote: I have always downloaded the latest from wordpress, created a DB on my server and

Re: Very hard to find MD5 checksum of Debian CDs!

On Sun, 18 Sep 2016, Richard Owlett wrote: On 9/18/2016 12:18 PM, david...@freevolt.org wrote: On Sun, 18 Sep 2016, Lisi Reisz wrote: On Sunday 18 September 2016 02:05:42 Shervin Emami wrote: At "www.debian.org" I clicked on "Getting Debian", and then to get a net install image there are 3

Re: Very hard to find MD5 checksum of Debian CDs!

TLDR: links to pertinent bug reports: #381555 - http://www.debian.org/CD/netinst/ : add link to iso md5 cheksum bugs.debian.org/cgi-bin/bugreport.cgi?bug=381555 #640054 - Download pages should have prominent links to image verification instructions

Re: Very hard to find MD5 checksum of Debian CDs!

Clarifying edits ("link" => "link's url") in square brackets, below. On Sun, 18 Sep 2016, david...@freevolt.org meant to write: 3. What web browser does not enable editing the current link['s url]? In firefox, one can right-click on a link, select "Copy link location" from a menu, and then

Re: Very hard to find MD5 checksum of Debian CDs!

On Sun, 18 Sep 2016, Lisi Reisz wrote: On Sunday 18 September 2016 02:05:42 Shervin Emami wrote: At "www.debian.org" I clicked on "Getting Debian", and then to get a net install image there are 3 different pages that all have direct links to the ISO files, but no link at all about how to get

Re: lynx - not all sites readable

On Thu, 15 Sep 2016, Hans wrote: Hi Karen, I tried as you described. However, this showed me the word "Treiber" but your better hint was the one with the letter "l". That way I can see, these links are hidden and could navigate to it (it is letter 107 here). In my lynx environment one must

Re: Gnome 3.21: how to define compose key?

On Tue, 13 Sep 2016, Doug wrote: On 09/13/2016 01:07 AM, david...@freevolt.org wrote: On Mon, 12 Sep 2016, Doug wrote: And ½, ⅓, ⅜, ©, 75°, µF, 17¢, and others.) I see recognisable glyphs for five out of seven of those. My environment does not support the other two. So I know what they are

Re: Errors when doing a update

On Tue, 13 Sep 2016, Jochen Spieker wrote: Brian LaPlante: Please find attached a copy of my sources.list and results of doing an update. Any corrections that need to be made would be greatly appreciated. Thanks in advance! If you want to solve your problem by editing your sources.list,

Re: Gnome 3.21: how to define compose key?

On Mon, 12 Sep 2016, Doug wrote: On 09/11/2016 11:47 PM, david...@freevolt.org wrote: On Mon, 12 Sep 2016, david...@freevolt.org wrote: And if I wanted that behavior all the time, I would edit the file /etc/default/keyboard, adding compose:rwin to the comma-separated list of pairs in

Re: How to arrange for booting to console

On Sun, 11 Sep 2016, Harry Putnam wrote: That sounds promissing. Used one of the methods below and quickly realized I was expecting a nice big framebuffered text console with a much higher resolution than the standard. (Previously my OS of choice was gentoo), But of course all that has to be

Re: Gnome 3.21: how to define compose key?

On Mon, 12 Sep 2016, david...@freevolt.org wrote: And if I wanted that behavior all the time, I would edit the file /etc/default/keyboard, adding compose:rwin to the comma-separated list of pairs in XKBOPTIONS. Of course, editing that file will change the default system-wide, for everybody.

Re: Gnome 3.21: how to define compose key?

On Sun, 11 Sep 2016, Joost Kraaijeveld wrote: I want to use my right super key (right win) as my compose key to be able to type accented letters. I don't use gnome, but I expect $ setxkbmap -option "compose:rwin" would do what you want. And if I wanted that behavior all the time, I would

Re: How to arrange for booting to console

If using systemd, these look relevant: How can I arrange to boot to console mode rather than X. https://www.freedesktop.org/wiki/Software/systemd/TipsAndTricks/#changingthedefaultboottarget # ln -sf /usr/lib/systemd/system/multi-user.target /etc/systemd/system/default.target With the

Re: Dual boot. Ubuntu update removes Debian GRUB.

On Fri, 2 Sep 2016, Stefan.schultz19.5.1991 wrote: Hello Debian support team, If you haven't figured it out yet, there is no such thing on this mailing list. We are a bunch of users of Debian who try to help each other. In principle, at least. Most of us. Brian at

Re: recent, stable (debian-based) desktop solution without blobs?

b.m wrote: Le 16.10.2014 11:05, Wim Bertels a écrit: Hallo, which distro would u recommend given the following wishes: [snip] - no blobs (ie closed firmware for example) in the kernel or default installation [snip] Is it correct to assume the only derivatives of debian containing no

Re: Moderated posts?

On Mon, 6 Oct 2014, Don Armstrong wrote: On Mon, 06 Oct 2014, Steve Litt wrote: Several of my posts to lists.debian.org have not made it to the list, as defined by both my inbox and the list archive. Threads which are off topic for debian-user may be filtered out by

Re: Debian policy on alternate init systems

On Mon, 6 Oct 2014, berenger.mo...@neutralite.org wrote: Le 04.10.2014 12:51, Joel Rees a écrit: 2014/10/04 17:30 Curt : On 2014-10-03, berenger.mo...@neutralite.org [2] wrote: I like this one, because it makes me smile. I like pieces of softwares with play on words (this

Re: Moderated posts?

On Mon, 6 Oct 2014, Steve Litt wrote: Hi all, Several of my posts to lists.debian.org have not made it to the list, as defined by both my inbox and the list archive. These posts all had something in common, and it was *not* swearwords or gratuitous personal insults. I replied to the list on

Re: Moderated posts?

On Mon, 6 Oct 2014, Don Armstrong wrote: On Mon, 06 Oct 2014, Steve Litt wrote: Several of my posts to lists.debian.org have not made it to the list, as defined by both my inbox and the list archive. Threads which are off topic for debian-user may be filtered out by

OT: gas plant (was Re: Issues upgrading Wheezy -- Jessie (was ... Re: brasero requires gvfs))

On Sun, 14 Sep 2014, B wrote: On Sat, 13 Sep 2014 22:46:31 +0200 lee l...@yun.yagibdah.de wrote: All interesting things you said, plus a bunch of other readings confort me in my first impression: Linux was becoming too much secured for the taste of agencies (and which better candidate than

Re: terminal doesn't come up in Jessie Beta-1?

On Tue, 9 Sep 2014, Lisi Reisz wrote: On Tuesday 09 September 2014 19:46:56 B wrote: On Tue, 9 Sep 2014 19:40:29 +0100 Lisi Reisz lisi.re...@gmail.com wrote: chacun à son goût Unfortunately for you, I'm french native; so the real expression is: à chacun ses goûts; which is commonly

Re: Query about .xsession-errors file

On Wed, 10 Sep 2014, Bret Busby wrote: On 10/09/2014, david...@ling.ohio-state.edu wrote: On Tue, 9 Sep 2014, Jonathan Dowland wrote: On Wed, Sep 10, 2014 at 01:54:08AM +0800, Bret Busby wrote: The file has (kind of) gone, now (it is no longer accessible, but, appears to still exist, in the

Re: Query about .xsession-errors file

On Tue, 9 Sep 2014, Jonathan Dowland wrote: On Wed, Sep 10, 2014 at 01:54:08AM +0800, Bret Busby wrote: The file has (kind of) gone, now (it is no longer accessible, but, appears to still exist, in the ether of the unknown; still taking up disc space, whilst, in theory, non-existent), A file

Re: finding a dependency chain

On Thu, 4 Sep 2014, david...@ling.ohio-state.edu wrote: On Wed, 3 Sep 2014, Rob Owens wrote: - Original Message - From: Kelly Clowers kelly.clow...@gmail.com On Tue, Sep 2, 2014 at 1:44 PM, Rob Owens row...@ptd.net wrote: I'm trying to figure out, for example, what causes brasero

Re: Choose your side on the Linux divide

On Sat, 6 Sep 2014, lee wrote: Zenaan Harkness z...@freedbms.net writes: On 8/28/14, Lisi Reisz lisi.re...@gmail.com wrote: On Wednesday 27 August 2014 22:51:13 Steve Litt wrote: you shouldn't express your opinion! Of course you should express your opinion, but not over and over and over

Re: finding a dependency chain

On Wed, 3 Sep 2014, Rob Owens wrote: - Original Message - From: Kelly Clowers kelly.clow...@gmail.com On Tue, Sep 2, 2014 at 1:44 PM, Rob Owens row...@ptd.net wrote: I'm trying to figure out, for example, what causes brasero to ultimately depend on systemd. I found a utility called

Re: Problem with Debian 6 LTS and vlc

On Thu, 14 Aug 2014, Bret Busby wrote: Hello. hi bret. I am not sure whether support queries specific to Debian 6 LTS, should be posted to this list, i assume such queries are on-topic here. or to the LTS list - on the web page at https://wiki.debian.org/LTS/Contact#debian-lts is

Re: Problem with Debian 6 LTS and vlc

On Thu, 14 Aug 2014, Go Linux wrote: On Wed, 8/13/14, Bret Busby bret.bu...@gmail.com wrote: [snip] Is vlc no longer installable, on Debian 6? --- I have vlc running on squeeze LTS. Looks like it

Re: Problem with Debian 6 LTS and vlc

On Fri, 15 Aug 2014, david...@ling.ohio-state.edu wrote: On Thu, 14 Aug 2014, Go Linux wrote: On Wed, 8/13/14, Bret Busby bret.bu...@gmail.com wrote: [snip] Is vlc no longer installable, on Debian 6?

Re: cannot find public key for verifying SHASUM file for debian live iso

Regarding whether keys used to sign debian-live releases are present (or not) in debian-keyring.gpg or debian-role-keys.gpg : On Mon, 11 Aug 2014, Francesco Ariis wrote: On Sun, Aug 10, 2014 at 10:34:21PM -0400, david...@ling.ohio-state.edu wrote: | $ gpgv --keyring

Re: cannot find public key for verifying SHASUM file for debian live iso

On Tue, 12 Aug 2014, david...@ling.ohio-state.edu wrote: Regarding whether keys used to sign debian-live releases are present (or not) in debian-keyring.gpg or debian-role-keys.gpg : On Mon, 11 Aug 2014, Francesco Ariis wrote: On Sun, Aug 10, 2014 at 10:34:21PM -0400,

cannot find public key for verifying SHASUM file for debian live iso

Good {evening,morning,afternoon}, fellow anglophones. I am running Wheezy, and I plan to prepare a debian live cd using this file: http://cdimage.debian.org/debian-cd/current-live/amd64/iso-hybrid/debian-live-7.6.0-amd64-standard.iso Before doing this, however, I would like to verify the

Re: cannot find public key for verifying SHASUM file for debian live iso

Hi Jimmy. Thank you for your reply. But please see below for comments. On Sun, 10 Aug 2014, Jimmy Johnson wrote: david...@ling.ohio-state.edu wrote: Good {evening,morning,afternoon}, fellow anglophones. I am running Wheezy, and I plan to prepare a debian live cd using this file:

Re: cannot find public key for verifying SHASUM file for debian live iso

On Mon, 11 Aug 2014, Francesco Ariis wrote: On Sun, Aug 10, 2014 at 10:34:21PM -0400, david...@ling.ohio-state.edu wrote: | $ gpgv --keyring /usr/share/keyrings/debian-keyring.gpg -vv -- SHA512SUMS.sign | gpgv: armor: BEGIN PGP SIGNATURE | gpgv: armor header: Version: GnuPG v1.4.12 (GNU/Linux)

Re: microkernels (I'm not a huge fan of systemd)

On Tue, 15 Jul 2014, Steve Litt wrote: On Tue, 15 Jul 2014 11:32:29 -0400 Frank McCormick debianl...@videotron.ca wrote: On 07/15/2014 10:37 AM, Steve Litt wrote: [snip] It would be interesting to read Linus's comments on MicroKernels...and why Linux is the way it is. Has he ever

Re: How to add package sources?

On Wed, 16 Jul 2014, Steve Litt wrote: Hi all, I'm trying to install install flashplugin-nonfree on Wheezy 64 bit on a dual core AMD, and it's been failing continuously. The error message is something to the effect that it can't reach mirrors.rit.edu, and in fact I cannot ping rit.edu, and

Re: How to add package sources?

On Wed, 16 Jul 2014, david...@ling.ohio-state.edu wrote: On Wed, 16 Jul 2014, Steve Litt wrote: Do I just put them below my corresponding rit.edu entries? sure, if you want the rit.edu ones to take precedence. man sources.list ...in particular, | It is important to list sources in

Re: What do you guys use instead of youtube-dl and minitube?

Hey Steve. On Sat, 12 Jul 2014, Steve Litt wrote: Hi all, The way I get throttled, occasionally the only way I can watch a Youtube video is to download it first and then watch it with smplayer. As far as I can see, Wheezy has no package for either youtube-dl or minitube. What are you guys

Re: What do you guys use instead of youtube-dl and minitube?

On Sat, 12 Jul 2014, david...@ling.ohio-state.edu wrote: $ ejynt='Mozilla/5.0 (Macintosh; Intel Mac OS X 10_8_2) AppleWebKit/536.26.17(KHTML, like Gecko) Version/6.0.2 Safari/536.26.17' Actually, you might not need to spoof the user-agent. But I've come to expect intentional breakage along

Re: GTK crashing X?

On Mon, 30 Jun 2014, Matt Ventura wrote: On 6/30/2014 10:13 AM, Brian wrote: On Mon 30 Jun 2014 at 09:11:01 -0700, Matt Ventura wrote: The system otherwise works completely fine. Packages operations work fine, so I don't think that's where the problem lies. There was no downgrading, just

Re: Reply To settings - was - Re: Debian 7.5 amd64 xfce GUI shutdown and restart do not work

Hi Bret. On Wed, 18 Jun 2014, Bret Busby wrote: On 18/06/2014, Steve Litt sl...@troubleshooters.com wrote: On Wed, 18 Jun 2014 00:28:45 +0800 Bret Busby bret.bu...@gmail.com wrote: Now, if only the list defaulted to Reply To List, it would be good, and, make replying to the list, easier...

Re: Reply To settings - was - Re: Debian 7.5 amd64 xfce GUI shutdown and restart do not work

On Thu, 26 Jun 2014, david...@ling.ohio-state.edu wrote: have you looked at alpine's roles? Main menu Setup Roles. Correction: Main menu Setup *Rules* Roles -- To UNSUBSCRIBE, email to debian-user-requ...@lists.debian.org with a subject of unsubscribe. Trouble? Contact

Re: No MD5SUM for old stable live debian

On Tue, 24 Jun 2014, laur...@leboucher.net wrote: May I ask why there is no MD5SUM for the old stable version of live debian? it sounds like, somewhere on the internet, you've managed to find a live install image of squeeze. may i ask where? knowing the answer to that might help answer your

Re: No MD5SUM for old stable live debian

On Tue, 24 Jun 2014, david...@ling.ohio-state.edu wrote: On Tue, 24 Jun 2014, laur...@leboucher.net wrote: May I ask why there is no MD5SUM for the old stable version of live debian? it sounds like, somewhere on the internet, you've managed to find a live install image of squeeze. may i ask

Re: mail client question?

hi karen. On Tue, 24 Jun 2014, Karen Lewellen wrote: greetings folks, My nonprofit organization has a hosting account with dream host. www.dreamhost.com As a part of the account we get a shell platform, text based fortunately for me. Because dreamhost uses debian for its accounts, the shell

Re: Reply To settings - was - Re: Debian 7.5 amd64 xfce GUI shutdown and restart do not work

On Sun, 22 Jun 2014, Tom H wrote: On Fri, Jun 20, 2014 at 11:31 AM, Bret Busby b...@busby.net wrote: On Fri, 20 Jun 2014, Bob Proulx wrote: This is one of those religious wars that has been fought and won and lost many times across the Internet. Please don't start it up again here. If you do

Re: Does LXDE really require lightdm?

On Sun, 22 Jun 2014, David Dušanić wrote: 22.06.2014, 02:31, Steve Litt sl...@troubleshooters.com: Hi all, I installed LXDE on a no-X, no-desktop virgin network Wheezy 64bit install with non-free software allowed, and on the next boot it went into lightdm. The only thing I could find that

Re: Does LXDE really require lightdm?

On Sun, 22 Jun 2014, B wrote: On Sat, 21 Jun 2014 20:31:50 -0400 Steve Litt sl...@troubleshooters.com wrote: 1) Am I correct that Debian's LXDE package installs lightdm? This is a recommend not a dependency. 2) Does that come from the LXDE project, or is it a Debian thing? I'd say a

Re: Off-topic: boot order

i had hoped that this bikeshedding BS over OP's domain name would blow over after ralf wisely reminded us to assume good faith. alas... On Sun, 15 Jun 2014, Curt wrote: On 2014-06-15, Ralf Mardorf ralf.mard...@alice-dsl.net wrote: However an English to German dictionary mentions, that the

Re: Preseeded setting on openssh-server ignored

On Sat, 14 Jun 2014, Bob Proulx wrote: The biggest problem I have found using random passwords is that some sites truncate the password to a shorter number of characters. Some of those are fairly high profile sites! http://www.schwab.com/ is a good example that truncates passwords at eight

Re: boot order

hi. EMAIL=root RESTARTSUBJECT=[`hostname` `date`] – System Startup SHUTDOWNSUBJECT=[`hostname` `date`] – System Shutdown RESTARTBODY=This is an automated message to notify you that `hostname` started successfully. Start up Date and Time: `date` SHUTDOWNBODY=This is an automated message to

Re: [0.5 OT] How to grab some entry by command line

On Thu, 12 Jun 2014, david...@ling.ohio-state.edu wrote: On Thu, 12 Jun 2014, lina wrote: Hi, I wish to grab part of the CDS entry from http://www.ncbi.nlm.nih.gov/nuccore/KF699528.2 namely, MLDHSSVNSTIAPGNLLNLPVWCYLLETEEGPILVDTGMPESAV

Re: [0.5 OT] How to grab some entry by command line

On Thu, 12 Jun 2014, lina wrote: Hi, I wish to grab part of the CDS entry from http://www.ncbi.nlm.nih.gov/nuccore/KF699528.2 namely, MLDHSSVNSTIAPGNLLNLPVWCYLLETEEGPILVDTGMPESAV NNEGLFNGTFVEGQILPKMTEEDRIVNILKRVGYEPDDLLYIISSHLHFDHAGGNGAF

Re: GPG Keys..... was Re: Should I install chkrootkit?

On Mon, 9 Jun 2014, Chris Angelico wrote: ...but I would consider it pretty silly if we had to concern ourselves with the possibility that some other debian-user contributor would show up on our doorsteps with an axe. Hm. We should not have to be considering such ridiculous possibilities.

Re: Problem with halt

On Tue, 29 Oct 2013, Wawrzek Niewodniczanski wrote: Recently I moved my home desktop from (x)Ubuntu to Debian Wheezy. The experience is positive, with one exception: shutdown doesn't stop power for my computer. I tried to play with settings in /etc/default/halt - both 'poweroff' and 'halt' have

Re: apt-get vs. aptitude

On Tue, 8 Oct 2013, Florian Lindner wrote: Since I'm about to setup a new server using current stable wheezy, I want to recheck some of debian knowledge. What is the prefered tool for installing on the CLI? apt-get or aptitude? Last time I read about it, it was aptitude, due to better

can has debian-reference manual (was Re: apt-get vs. aptitude)

On Tue, 8 Oct 2013, Stephen Allen wrote: On Tue, Oct 08, 2013 at 11:35:57AM -0400, david...@ling.ohio-state.edu wrote: On Tue, 8 Oct 2013, Florian Lindner wrote: Since I'm about to setup a new server using current stable wheezy, I want to recheck some of debian knowledge. [snip] you might

Re: You can have any color you want - as long as it's Gnome?

On Sun, 6 Oct 2013, Jape Person wrote: On 10/06/2013 05:33 PM, david...@ling.ohio-state.edu wrote: On Sun, 6 Oct 2013, Jape Person wrote: For both stable and testing I tried both LXDE and Xfce desktop environment installations. But when the systems rebooted, I was at the Gnome desktop.

Re: NEWBIE installation report - was [Re: You can have any color you want - as long as it's Gnome?]

On Mon, 7 Oct 2013, Richard Owlett wrote: I just did an install from [Debian GNU/Linux 7.1.0 Wheezy - Official i386 DVD Binary-1 20130615-21:54] My choices from the the opening set of menus were: Advanced Options Alternative desktop environments Xfce Advanced options Expert install

Re: You can have any color you want - as long as it's Gnome?

On Sun, 6 Oct 2013, Jape Person wrote: For both stable and testing I tried both LXDE and Xfce desktop environment installations. But when the systems rebooted, I was at the Gnome desktop. you do not mention the display manager. at login, did the display manager's login dialog box not offer

Re: Re: How to install latest VLC 2.1.0 in debian

two things. thing number one: On Sun, 6 Oct 2013, Chris Bannister wrote: On Sat, Oct 05, 2013 at 11:15:05AM +0530, Anubhav Yadav wrote: Actually, I just changed the subject of another thread and it came up as a different thread on mailing list! I will try out the deb-multimedia repository.

Re: autostarting a terminal.

On Wed, 2 Oct 2013, Sarunas Burdulis wrote: On 10/02/2013 09:17 AM, peasth...@shaw.ca wrote: Given ~/.config/autostart/openaterminal.desktop containing Exec=lxterminal Terminal=false a terminal is opened on the desktop following login. If the two lines changed to Exec=sh Terminal=true

Re: Security?

regarding startpage and its default behavior, On Thu, 12 Sep 2013, recovery...@gmail.com wrote: TOR project seems to think that duckduckgo startpage. Not that this 'enabled by default family filter' bothers me, but it can lead to unexpected results, as shown here:

Re: Re: Security?

On Wed, 11 Sep 2013, Ralf Mardorf wrote: I dislike Google, but if I search something I very often end up with using Google. Duck Duck Go and ixquick very often fail. according to my understanding, https://startpage.com ... is a google scraper, sort of like what scroogle used to be, and

Re: Security?

On Mon, 9 Sep 2013, Joel Rees wrote: On Mon, Sep 9, 2013 at 3:27 AM, lati...@vcn.bc.ca wrote: Hello list. What do you think about it? https://www.schneier.com/blog/archives/2013/09/the_nsa_is_brea.html Those that didn't know about it were gobsmacked. NOBODY expects the Span--*cough*

Re: gnu screen key binding question - bind a key to: stuff a command + unbind the key binding?

On Tue, 3 Sep 2013, Zenaan Harkness wrote: Does anyone know off-hand how to bind a key in .screenrc, eg bindkey -k k8 screen so that the bound key causes some keystrokes to go into the terminal to run that command, as well as at the same time (probably just prior, or after) to unbind that

Re: Missing Makefile

On Wed, 31 Jul 2013, Jerry Stuckle wrote: Hi, all, I was sent here by the debian-devel list people. Hopefully someone here can help me. I'm trying to compile my first module for Debian (right now it doesn't do anything - one step at a time ). My makefile is: obj-m = mymodule.o KVERSION

<    1   2   3   4   5   >