At 09:23 17/01/2008 +0100, you wrote:
>I'm sure Per said that he had Bruce on the case and to 'watch this space'.
>He then mentioned this "gilfaethwy" person -
Mea culpa, I missed that at the bottom thinking the rest to be quoted text.
But where have they been for so long, some inter-galactic no
Has the subject moved on fro Per's missing mails ?
I have just had four postings returned as undeliverable,
though they have appeared in the List from Oct' last to the 8th of Jan.
Each having been on a long journey
[EMAIL PROTECTED]
from montecristo.dreamhost.com
(helo=frida.dreamhost.com) by bd
At 23:11 07/01/2008 +, you wrote:
> >> Go to control panel (classic view) -> administrative tools ->
> >> services
> >> Then find Indexing Service.
> >> Right click on it and STOP the service
> >> Right click and select properties - change startup to Disabled.
>Ah, thanks. Done.
>
> > When clic
At 11:12 02/12/2007 +, you wrote:
>In-Reply-To: <[EMAIL PROTECTED]>
>I am not sure Tony that you are thinking of an old-fashioned AT power
>supply. The latter have 2 six pin plugs - i.e. no pins 14&15. They also
>do not use a green wire. The only pin neither ground nor a given voltage
>is the P
At 18:06 30/11/2007 +, you wrote:
>When I assembled my Q60, I just used a PC case that came to hand. The
>motherboard power on this is delivered by two connectors labelled P8 &
>P9. To get the power supply to switch on in the absence of a M'board
>using these plugs I had to link one of their li
At 17:13 18/10/2007 +0100, you wrote:
>of course, i clearly remember my first day in infants school when i was 4
>or 5.
A sort of uncertain clarity - like "I used to be indecisive . . . now I am
not so sure"
___
QL-Users Mailing List
http://www.q-v-d.d
At 21:01 10/10/2007 +0100, you wrote:
> >Same for me: there definitely must be some differences in the brains
> >on the Island vs continent! (no offense meant: without the big island
> >we would not have the QL!)
>
>There is no offence. This really concerns the finer nuances of a word
I too immedi
I have been severely rebuked by a gentleman who wishes to be known as an
"attendee" at the Birmingham Workshop. He assures me that his nautical
ambitions are zero and that he has never been on a punt in his life.
Pity he is not a reader of this list, nor of dictionaries it would seem.
There is
My last post took less than 2 mins to come back to me, yesterday they were
taking an hour - wonder where and why.
Makes for a turgid interchannge
___
QL-Users Mailing List
http://www.q-v-d.demon.co.uk/smsqe.htm
At 10:29 05/10/2007 +0200, you wrote:
>But you're fully right as "and" word is very well traducted by Google too
>!!! ;-) I think I'm very tiring very early
>this morning...
>So for everyone who help me you may not answer to translation of this very
>simple word.
Please dont confuse traduce with
>
>We are going via the M$) (in the same vein.
>
>Where are you coming from?
Nth Cambs - Nr Peterbro'
Have a friend nr Northampton, would have held my wagon.
Never mind - enjoy - thanks for the thought
___
QL-Users Mailing List
http://www.q-v-d.demon
At 15:26 04/10/2007 +0100, you wrote:
>I assume being a "tight wad" your one reason was money?
>(... or have you found another reason now (8-)# )
>
>Tony
The sheer effort of driving - less enjoyable than in the past.
More traffic and ano domini
___
QL-U
At 15:26 04/10/2007 +0100, you wrote:
>I assume being a "tight wad" your one reason was money?
>(... or have you found another reason now (8-)# )
>
>Tony
The sheer effort of driving - less enjoyable than in the past.
More traffic and ano domini
Kind offer, but up top of Cambs.
Do you go up M! ?
I have been wishing and hoping, being an old-fashioned tight wad I just
cant do the trip for just one reason, been looking for another but no joy.
I should like to have met Simon and thanked him for work he did long ago on
floppy disk layout.
At 13:28 04/10/2007 +0100, you wrote:
>Just a remind
At 16:52 17/09/2007 +0100, you wrote:
> > W98 & XP will suggest opening a folder to view files - do that -
>That will be the "normal" way of doing things, I just thought putting
>a simple batch file in was a quick way for people to start it until I
>can figure out how to do a decent simple Windoze
Remember the tale, Paddy, when asked for directions said "Oh no ! If I was
going there I would not start from here."
At 17:26 16/09/2007 +0100, you wrote:
>I need some help to create a little DOS batch file to select QL
>emulators.
>
>My flash memory drive has QPC, QemuLator and QLay on it, so I
At 17:46 11/09/2007 +0200, you wrote:
>David Tubbs a écrit :
> > I have never known what this was for and always wondered why it got
> into my
> > Boot prog
> >
>
>
>Well, now you know what it's for... :-)
Hardly
Appologies for SPAMMING !
So I will say G
I have never known what this was for and always wondered why it got into my
Boot prog'
___
QL-Users Mailing List
http://www.q-v-d.demon.co.uk/smsqe.htm
At 15:52 22/08/2007 +0200, you wrote:
> > Donaudampfschiffahrtsgesellschaft
>
>I challenge you to translate that into less than 5 English words :)
Danube steamship co,
when I went to school it was claimed that the longest word in German
(Austrian ) word was for that to include the captains widow
At 15:03 21/08/2007 +0200, you wrote:
>at least he did not say he is going to be on a tour on a ship of the
>Donaudampfschiffahrtsgesellschaft :)
>Aber veleicht treft er mit die
>Donaudampfschiffahrtsgesellschaftkapitainswitve ?
___
QL-Users Mailing Li
Pleased I am to have recently got the modern version (courtesy of Rich Mellor
who helped me pass the UNZIP) I am finding a couple of problems - features
or bugs.
I am using Qemulator, and my devices are just MSDOS/Windows directories.
While editing an existing file, then wishing to save to the sa
At 21:47 28/07/2007 +0100, you wrote:
>Copy Date for the next Quanta Magazine is August 5th. - just about a week
>away and I hope to have more details regarding the West Midlands "Autumn"
>Workshop by then.
Atlast something nearer the center of gravity of the country, how, I
wonder, does that co
At 18:17 25/07/2007 +0100, you wrote:
> > Was a quote from:-
> > http://www.cs.rice.edu/~ssiyer/minstrels/poems/228.html
> >
> > for the function would you not just use EDITOR or FILED, or a
> > trivial basic
> > routine ?
>Ah, I see.
>
>Yes of course, an editor or Filed or something similar could
At 20:22 24/07/2007 +0100, you wrote:
> >. . . . . the night we went to Birmingham by way of Beachy Head . . .
> >. . .
> >
> > GKC
> >
> > Or is there a longer way round ?
>
>Eh??
>
>Oh well, that's that one killed stone cold dead then :-(
>--
>Dilwyn Jones
Was a q
. . . . . the night we went to Birmingham by way of Beachy Head . . . . . .
GKC
Or is there a longer way round ?
___
QL-Users Mailing List
http://www.q-v-d.demon.co.uk/smsqe.htm
At 13:17 10/07/2007 -0400, you wrote:
>Thanks but I have that document. I wanted to test the idea that the QXL.win
>format was the Qx0 hard disk format by copying a Qx0 disk to a file and
>see if
> QPC2 would recognise it as a QXL.win file.
>
I have not had dealings with QDOS HDDs but I would sug
At 21:56 11/07/2007 +0100, you wrote:
>With SBYTES you can do something like SBYTES ram1_test,address,0 which
>creates a not very useful zero length file. But if you try to LBYTES
>it back with LBYTES ram1_test,address you get the error message 'end
>of file'
Seems more like a statement of fact t
At 13:35 08/07/2007 -0400, you wrote:
>What is an HE editor?
Should have been HEX, a crumb under the key
>
>What I want to do is clone the Qx0 hard disk into a QXL.win file
>
I thought you wanted to compare the two.
There is a document that explains exactly how a QXL.WIN fie is made up,
bytes,
At 14:52 07/07/2007 -0400, you wrote:
>but does not work on QPC2 to access Qx0 formatted CF cards! I get
>error -1.
>
>Help appreciated
To be epected as QPC2 is using Windows/DOS/BIOS to read device.
I use a HE editor that not only opens files but also a device, which it
reads sector by sector.
At 20:35 03/07/2007 +0100, you wrote:
>BT told Demon that I had moved so
>Demon cancelled my account yesterday (2/7/07) - they did send an email
>to tell me this - but they sent it to the closed account. Eh
BT are very cavalier, they buggered me around when Orange stopped my BBand
through inc
At 11:08 30/06/2007 +0100, you wrote:
>I have a couple of second hand MicroP disk interfaces - these were the
>ones which used FDK as the drive identifier (rather than FLP) - does
>anyone know of any means of patching them to change the identifier from
>BASIC, or do I need to patch the EPROM code a
http://online.ogcbuyingsolutions.gov.uk/catalogue/details.html?variant_id=682625
At 23:11 31/05/2007, you wrote:
>John Butterworth's query as detailed below was
>bounced back and never appeared on the ql-users
>list so here's another attempt. Can anyone help him?
>
>Regards,
>
>John Gilpin.
>
At 23:59 29/05/2007, you wrote:
>He did not respond to me either, and I sold it to someone else!
>
>Tony
There are so many who enter a communications medium without the
ability or courtesy so to do.
--
No virus found in this outgoing message.
Checked by AVG Free Edition.
Version: 7.5.472 / V
At 00:05 30/05/2007, you wrote:
>Ah, unless I've misread Tony's response... I think that there was an
>offer of £50? I may be wrong. But I would like it, and will pay
>promptly, if I'm remembering the price right and you still have it!
>
>I assume I need an old(er) PC and some software for it?
Sof
At 15:12 29/05/2007, you wrote:
> >>>An Mdv can be connected at the side
>How so, spectrum microdrives?
I was not aware that cased mdvs were exclusively Spectrum.
The internal mdv sockets are bridged so the first external comes in
as No 1, chain upto eight.
PS, forgot to mention I still have th
I have a unique QL, house in an attache case size aluminium box
Dual ROM, MG and Minerva.
512 Expanderram
Twin floppies and interface
256k EPROM
Pointer env, QPAC, Editor and more
all rear QL connectors are at the front
An Mdv can be connected at the side
A separate hand hardwired keyboard
At 13:49 12/05/2007, you wrote:
>[EMAIL PROTECTED]
>
>is a valid format string for internet e-mail addressing?
Looks OK but their site does not seem to be offering email a/cs, do
you have to aquire a domain first ?
A word of warning, with the user ID being after the "@" is much more
prone to sp
At 17:48 05/05/2007, you wrote:
>SGC would be great, as I keep having trouble with 3.5's not writing
>properly, which the proverbial "friend who knows a lot about
>hardware" (but little about QLs specifically) says it's probably
>whatever controller is on the disk interfaces.
In the old days one
At 20:10 02/05/2007, you wrote:
>Could that be useful to you too ... ?
Very poor, tho' good for killing startop progs, the DEFRAG is
pathetic, it left 200 files in 1800 pieces for XP to clean up. The
graphic was utterly deceptive.
>You have to register, when installed, which just means you then
At 12:32 02/05/2007, you wrote:
>Yes - but a great deal of very good info.
>It is alarming, for instance, to see all ones passwords stored unencoded.
More use in cracking open someone else's machine
--
No virus found in this outgoing message.
Checked by AVG Free Edition.
Version: 7.5.467 / Vi
At 16:54 01/05/2007, you wrote:
> > Try www.gtopala.com Very useful [and free for private use] :-)
>Searched in vain for a download.
>THis is a better link:
>http://www.shareup.com/SIW-download-23742.html
>
>Tony
It was a struggle to find the download, and when done just loads of
info but no
At 18:12 01/05/2007, you wrote:
>[1] As each sector has a file number and block number, it's position in the
>file is instantly recognised when read and if a later block happens past the
>read head before an earlier one, it is loaded first, into the correct memory.
Getting a bit too deep for my re
At 15:10 30/04/2007, you wrote:
>I must admit, I was assuming Sinclair had used 1024 byte blocks on his
>microdrives - I may need to be corrected on that.
512 byte seectors.
one map sector, one byte for each potential sector, I had a few mdvs
of 250 sectors.
Note tpp, every file fragmented of n
>
>Ho ho ho - I like it :o) I presume you are referring to the hardware
>- caught out by my inability to speak (type) English yet again !
Not your English that's the problem, but trying to pass off Seattle
speak and NTFS obfuscatory patois is.
Hi-jacking a decent English word and giving it a l
At 20:16 22/04/2007, you wrote:
>Javier Guerra writes:
>
> >> At 20:57 19/04/2007, you wrote:
> >>
> >>> I do have a QXL card standing Idle, dont think I shall have room for
> >>> a box with ISA slots again.
> >>>
> >>> Make me an offer !
> >>>
> >> I'm watching - waiting to see what Sergiusz has
At 08:24 23/04/2007, you wrote:
>[EMAIL PROTECTED] wrote:
>
> > Every time I use it I get the reassuring answer that the hard drive does
> > not need a Defrag.
>
>I think it has to be *really really* bad before you get told to
>defrag. I recently did lots of deletions and a general housekeep
>he
At 22:25 21/04/2007, you wrote:
>Yes 3.01 is an early version - I have been trying to help this user off
>the list, but I'm darned if I can remember how to get plus4setup to work
> from win1_ - it looks for its configure files on flp1_
If it is not an egg sucking lesson could you not change driv
At 20:57 19/04/2007, you wrote:
>I do have a QXL card standing Idle, dont think I shall have room for
>a box with ISA slots again.
>
>Make me an offer !
I'm watching - waiting to see what Sergiusz has to say.
--
No virus found in this outgoing message.
Checked by AVG Free Edition.
Version: 7.
At 16:07 18/04/2007, you wrote:
>As there are more and more new QLers (among which I'm counting myself
>too), as well as returning ones, I'd like to try again and ask if anyone
>here have unneeded SGC and/or QXL card. I know there are many people
>with such a needs, but maybe I'd be the lucky one :
At 09:27 17/04/2007, you wrote:
>OK, I give up. How do you get Windows XP to format a new second hard
>disk?
>
>I uninstalled the old drive D:\, switched off, restarted, the New
>Hardware Wizard found the new drive and it's now listed as drive D:\
>in
>Device Manager.
>
>Now, how do I format it? I
At 09:55 14/04/2007, you wrote:
>However a Google search for "QL wiki" already throws up Rich's one as #1
> along with our chats here. The first QL wikipedia link is way down
>and is "The Philips QL, an induction lighting system by Philips" is
>above Sinclair!
I imagine Google takes date of th
I have been puzzled by the connection between inserting QLAY and huge discs.
Qlay can be tucked away anywhere, even a memorystick.
The handling of large discs by older PC's is not just a factor of MSDOS but
many BIOS had limitations, I recall one (686 500Mhz) that saw no more than
15gig untill
At 23:01 18/02/2007 -0500, you wrote:
>David Tubbs wrote:
NO I DID NOT ! ! ! ! ! !
> > At 19:30 15/02/2007 +, you wrote:
> >
> >
> >>>Then there's the lack of USB and printer support.
> >>
> >>But just a provocative thought. H
At 19:30 15/02/2007 +, you wrote:
> > Then there's the lack of USB and printer support.
>
>But just a provocative thought. Have you ever tried to connect a USB only
>laptop to a parallel printer? PC World don't know the answer to that one,
>but I do mainly because of my QL experience of lookin
This discussion raises a couple of questions in my mind.
a, Do the emmulators use the same interleave factor as on the QL, the
default, I think, was three, but could be altered in the definition block.
b, Whereas the PC (I did come by one of the originals) used none, writing
was as far as poss
At 21:10 30/01/2007 +, you wrote:
>Did Jonathan also work with QJump at one stage? I'm sure he had a hand
>in some QJump products like QRAM and so on.
After Sinclair took the Sugar coated pill he worked with Tony T at Rampton,
no not the hotel for the criminally insane, before joining a Team
Sorry, Norm,
Twas under that Subject I read Tony's French tour !
D
At 12:18 22/09/2006 +0100, you wrote:
>Thanks.
>(I think !!!)
>
>Cheers,
>norman.
>
>[EMAIL PROTECTED] wrote:
> > At 10:41 22/09/2006 +0100, you wrote:
> >
> > Probably, I can see no connection !
> >
> >
> > --
>
>
>
At 10:41 22/09/2006 +0100, you wrote:
Probably, I can see no connection !
--
No virus found in this outgoing message.
Checked by AVG Free Edition.
Version: 7.1.405 / Virus Database: 268.12.7/454 - Release Date: 21/09/2006
___
QL-Users Mailing List
At 08:49 15/09/2006 +0100, you wrote:
> > Two tears
>What a superb typo.
Disklesia often provides a little humour.
>ago I was wondering what the QL world consisted of and suggested
> > a survey.
> >
>
>
> > PS I wont throw the age into the pot, suffice to say that cynicism of this
> > order need
At 19:33 14/09/2006 +0100, you wrote:
>I now have a little exercise for the committee. Look up the membership for
>the last ten years, plot this on a graph and then extrapolate it to
>determine membership at the end of the 3 year term of the current officers.
>You are in for a nasty shock!,
I had
>
> Tony: Re - "Best way to check is to Google for your literal email
> address"
> Go on. Tell the uninatiated (like me). Please. ;-)
>I am not sure what you mean. I just type my email address in, literally,
>into a Google search box. What did you think I meant? It used to find
>
At 17:42 19/06/2006 +0100, you wrote:
>I don't know if standard Gold Cards can see FLP3_ without the little
>external disk expander card for FLP3_ that Miracle made for a while.
>
>I'm not sure about the crossed over cables, I've never tried those.
>I've always used the drive selector jumpers on d
John Gilpin wrote:
Under an irrelevant subject head.
>I must respond, as a non-footballing Manchester resident, as are most of
>Nemqlug's members,
>I can't understand your comment about Manchester always being a difficult
>location for a show. It has a brilliant transport network of motorways, lo
At 13:21 04/06/2006 -0400, you wrote:
>Not everything with a plural can be quantified:
>See for example "waters" as in The waters of the Gulf of Mexico...
>
>You could potentially count their displacement but then you have to prefix
>it with "amounts". There is a plural in waters however you canno
At 14:51 04/06/2006 +0100, you wrote:
> >
>Not my nit.
No, I just acknowledged the appropriateness of your picking it.
>Who else uses "iff" for "if, and only if,"? All the logicians and
>mathematicians, stand up please. The rest of you (philosophers excepted,
>if they exist) can sit down.
>
> >
>
>Just to wind up this one, from way back, Tony Firshman wrote:
>
>Being me, I took TF at his word, that the rule should be "countable",
>and went onto my "infinity" theme.
Sorry Lau, I did not take your point correctly, but certainly a nit for the
picking.
but does the of a finite line by the
At 10:13 01/06/2006 -0400,
=?windows-1253?B?UGhvZWJ1cyBSLiBEb2tvcyAo1u/f4u/yINEuIM30/Orv8ik=?= wrote:
>I would say that usability defines what is right. The perfect example
>would be Greek.
I can see that could be the case for a Grecian.
>Ancient Greek for example had words for almost everythi
At 10:38 02/06/2006 +0100, you wrote:
> Reading through them you might think that
>you were on the 'Never Mind the Full Stops'
Mentioned in the first posts under this heading.
>news group, rather than
>Ql-users!
>
>Please, please get back on topic!
>
>Cheers
>
>Colin
I am sure you are more than
>
>Most programming languages (like current C implementations) use the
>IEEE format for numbers, which includes +/- infinity and NaN (not a
>number. sqrt(-1) is NaN for example), though real language support to
>deal with these circumstances is often poor.
>
>Curious fact: there are also 2 zeros!
At 13:30 31/05/2006 +0100, you wrote:
>There is no missing apostrophe. The people's, yes, but in this case
>peoples is plural.
>
>John.
But do you mean the Pidgeon and bastardisation of English by peoples around
the world or "correcting another person's English"
--
No virus found in this ou
At 12:48 31/05/2006 +0100, you wrote:
>PEPS. Infinity. I considered introducing infinity in Minerva, but I
>wouldn't have been happy with just the one.
>
>--
>Lau & Marcel
So if it is possible for the computer to handle infinity how and where is
it done ?
Processor or co-processor ?
Operating s
At 10:23 29/05/2006 +0100, you wrote:
>As I thought, but shirley "you and I", the subject of the missing/implicit
>verb is plural (together as one pronoun: "we") and so would use "are" and
>not "am"?
Ah I see what you mean - "You and I" is the plural.
Since the verbs are invisible how can you t
At 11:53 28/05/2006 +0100, you wrote:
>This one has a blutooth COM port, but for some unfathomable reason it has
>set its heart on COM10!. Will check if other software has grabbed the lower
>ports and try to change it.
I was troubled for ages with instalations of W98 only providing COMMS 1 & 2
a
At 00:31 26/05/2006 +0100, you wrote:
>Not sure if your question is for real, if it is you have defined the
>subject as numeric, since most (if not all) computers throw a wobbly at
>infinity the answer must be less.
OOOps, boobed did not mean that, obviosly fewer ! But curiously still a
lesser nu
At 20:10 25/05/2006 +0100, you wrote:
>(Surprise, surprise... I do still exist).
Good on yer
Belated thanks and congrat's for Minni
From one of the old Lolworth crowd.
>I couldn't resist getting in on this one... for two reasons.
>
>Firstly, there are more good bits in "Never Mind the Full Stop
Sorry Per,
The riposte was aimed towards the reader who discerned.
At 19:29 21/05/2006 +0100, you wrote:
>I didnt watch it, and quite enjoyed that. Another one I enjoyed not watching
>was Grumpy Old Men..
>
>BTW the apostrophies are not missing, Ive merely removed redundant
>information for the
At 16:40 20/05/2006 +0100, you wrote:
>By that you mean Central and North London ?
Roger
>I can check this weekend.
>
>--
>Malcolm Cadman
--
No virus found in this outgoing message.
Checked by AVG Anti-Virus.
Version: 7.1.392 / Virus Database: 268.6.1/344 - Release Date: 19/05/2006
_
At 23:52 19/05/2006 +0100, you wrote:
> > Youre welcome
> > Youre welcome
> > Youre welcome
>
>Three missing apostrophes (8-)#
>
>Tony
Did you watch "never mind the full stops" ?
Bit disappointing I thought.
D
--
No virus found in this outgoing message.
Checked by AVG Anti-Virus.
Version: 7.
At 20:50 18/05/2006 +0100, you wrote:
>The next meeting is this Sunday 21st May 2006, which was moved from the
>regular second Sunday of the month.
>
>In June we are back to the usual second Sunday, so 11th June 2006.
Neither date very likely on present view, any member above the river who
migh
Tony's flyer brought to mind once again an odd thought.
Is there a hint of unfriendliness in J leaving the Quiet Corner to march
(Merz) with Kaiser Bill ?
Has anyone else been so struck ?
--
No virus found in this outgoing message.
Checked by AVG Anti-Virus.
Version: 7.1.392 / Virus Database:
I have just taken a box out of service,
A PC with a small Linux facility on board to act as a stone firewall
between ADSL modem and Ethernet hub.
Beyon the two network cards there is nothing in it.
Presently at PE15 9NF, could be brought to London soon.
Anybody want it ?
--
No virus found i
Is that Malaprop, Spooner or just kindergarten like Windoze, ugh, makes me
cringe.
At 20:56 04/05/2006 +0100, you wrote:
>For those of you who don't subscribe I should point out that there is
>a lot of useful information in it. Some issues get a little over
>technical but then others redress the
At 03:14 06/05/2006 +0100, you wrote:
> >> as68.txt = 4KB
> >> as68.doc = 6Kb
> >> as68.html = 12Kb
> >> as68.pdf = 549Kb (!) high-res
> >> as68.pdf = 549Kb (again) low-res.
See what the sizes can be by creating a pdf in Windows, it strikes me that
above is based on a pixel image rather than usi
>
>
>I agree with you about PDF, it is a good universal format. Although the
>file size can get quite large.
Compression factors are variable in pdf. I ca imagine a DIY pdf might be
huge, in the way an MS WORD html is, setting font type,size colour each line.
Sometime ago I needed to email a W
At 18:59 19/04/2006 +0100, you wrote:
>I'd intended to put the JS ROM into the MinisQL but it was only when I
>opened it up that I remembered that Sinclair ROM pairs have to be
>piggy-backed into the single Aurora rom socket. So the piggy-backed JM
>stays in that machine. So now I have a QL with QL
>
>Usage does not govern the life. The plastic gets brittle and cracks is
>moved. All the original QLs had their tails bent right back where they
>emerged. They usually break there. If the curve there is gentle and
>the QL is not opened, they should last for ever.
Ardent non-smokers amongst y
Is it ? Or a way to keep up with the past ?
At 23:06 15/04/2006 +0100, you wrote:
>This is what I use successfully:
>
>http://www.lektropacks.com/view_item.php?product=46&&category=13
I am always amased at the amount of money that seems to be available to
people. Long since my dual sync monitor
> Only longer periods of no or very low
>usage tends to cause the jet blockages again.
Right, the worst treatment for an inkjet printer is NONE.
A cleansing fluid sold alongside the refill inks is carbontetrachloride, or
it's health&safety substitute. Industrially a de-greasing agent, also use
have noted that
?windows-1253?B?UGhvZWJ1cyBSLiBEb2tvcyAo1u/f4u/yINEuIM30/Orv8ik=?=
and
?utf-8?B?XCJQaG9lYnVzIFIuIERva29zICjOps6/zq/Oss6/z4IgzqEuIM6dz4TPjA==?=
=?utf-8?B?zrpcIlwizr/PgilcIg==?=
and
Tony Firshman
are correspondents most likely to complain of "off topic" !
--
No virus foun
>
>
>Could someone kindly recommend the best program (ideally PD) to batch
>undelete files from a QL floppy which has most of the files deleted. I know
>one needs to make a guess as to the executable storage size, and also there
>are programs which allow manual restoration a file at a time, but p
Hey ho !
deja vu !
I personally recall encountering this aggro' some 10 years ago, and again
only two years ago, it would be the same if I got into the process now.
A pity the zipping in each OS is some similar save that it is too easy with
Winzip and a pain with the sometime working QDOS vers
At 20:51 22/02/2006 +, you wrote:
>Basically, what I'm up to is following John Gilpin's lead, I've put a
>list of the programs I've written with version numbers, release dates,
>requirements (PE, TK2, etc) into a spreadsheet which I'd like to put
>online with an option to view it online (hence
At 13:46 15/02/2006 +0100, you wrote:
> Easy to transfer the dos1_xxx.txt to win1_xxx_txt and then
>run win1_sort_bas using win1_xxx_txt and send it back directly to
>dos1_xxx1.txt
Ah yes, you do neatly emphasise the clumsiness of file transfer, if only
directory and suffix separators where in
At 13:07 29/01/2006 +, you wrote:
>There are now so many QL people near me it is almost worth a show in the
>local scout hut (opposite me) - only joking (I think).
Much more to the point than all those peripheral venues !
--
No virus found in this outgoing message.
Checked by AVG Anti-Vi
To the King of Ur
Great web page, most informative and comprehensive.
Quanta should learn !
At 12:30 20/01/2006 +0100, you wrote:
>Today, exactly 20 years ago I bought my personal Sinclair QL
>computer (German edition). Read it here and see the
>cash registers receipt (proof of purchase):
>http
>One of my contacts using freeserve,co,uk is having terrible trouble.
>Approximately 50% of her emails get filtered out somewhere in transit.
As you see, I use same, and Wanadoo ISP, they don't remove spam, just mark
it. Very little gets under and a tiny number of false positives. And they
do
I am using Qlem with Minerva, so sweet to see it all again, and it really
is fast.
Mostly for the manipulation of text files from the PC, for me it is the
interactivity of SuperBasic and Editor that suits me.
But through much moving & storage a great deal has been mislaid. Can anyone
pass me t
At 08:41 17/01/2006 +, you wrote:
>[EMAIL PROTECTED] wrote:
>
> > Probably because their pint = 16FlOz to match 1lb = 16Oz, whereas the
> > imperial pint = 20flOz.
> >
>Cheers,
>Norman.replied to a mail that never reached me ? ? ?
One is inclined in general to that if one gets no reply to an
At 15:58 14/01/2006 -0500, you wrote:
>Then of course we're using miles and pounds still :-)
Don't forget British thermal units, Btu's,
or BSP, British Standard Pipethread, and inspite of our metrication it used
across Europe too, inch=zoll=bulgado.
If you want a pint go to Starbucks for a "vin
At 00:34 11/01/2006 +0100, you wrote:
>Excuse me for interrupting this highly interesting conversation,
Spott ?
>but
>I'm curious, by what accident did you lose your ability to quote
>correctly?
> I certainly hope nobody else was injured in it ;-)
If I have your meaning right,Injured is a bit s
101 - 200 of 219 matches
Mail list logo
